CNTF Protein, Human

1 Cited Publications
Revisión del cliente

Based on 1 publication(s) in Google Scholar

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family. CNTF could protect retinal cone and rod photoreceptors. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. CNTF Protein, Human is produced by E. coli (A2-M200) with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Referencias
  • Help & FAQs

Actividad biológica

Descripciòn

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human is produced by E. coli (A2-M200) with tag free.

Background

Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.

In Vitro

CNTF (human; 20 ng/mL; 3 d) significantly inhibits the activity of choline acetyltransferase (ChAT) in mesencephalic cultures[4].

Verified Bioactivity

The ED50 is <200 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5 × 103 units/mg.

Results
  • Experimental Validation Results for CNTF Protein, Human
    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1749 μg/mL, corresponding to a specific activity is 5.717×103 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CNTF (A2-M200)
      Accession # P26441
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rHuCNTF; Ciliary Neurotrophic Factor

  • AA Sequence

    AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

  • Predicted Molecular Mass

    22.8 kDa

  • Peso molecular

    Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for CNTF Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Referencias

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00