CNTF Protein, Human
Based on 2 publication(s) in Google Scholar
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family. CNTF could protect retinal cone and rod photoreceptors. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. CNTF Protein, Human is produced by E. coli (A2-M200) with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human is produced by E. coli (A2-M200) with tag free.
Background
Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.
In Vitro
CNTF (human; 20 ng/mL; 3 d) significantly inhibits the activity of choline acetyltransferase (ChAT) in mesencephalic cultures[4].
Verified Bioactivity
The ED50 is <200 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5 × 103 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
EMBO Mol Med
Isoginkgetin antagonizes ALS pathologies in its animal and patient iPSC models via PINK1-Parkin-dependent mitophagy. [Abstract]2025 Oct 15. PMID: 41094045
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P26441 (A2-M200)
-
Molecular Construction
-
N-term
-
CNTF (A2-M200)
Accession # P26441 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CNTF; HCNTF; Ciliary Neurotrophic Factor; Ciliary Neuronotrophic Factor
-
AA Sequence
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
-
Predicted Molecular Mass
22.8 kDa
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18(12):773-789. [Content Brief]
[2]. Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17(7):912-21. [Content Brief]
[3]. Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293(39):15256-15268. [Content Brief]
[4]. Pasquin S, et al. Ciliary neurotrophic factor (CNTF): New facets of an old molecule for treating neurodegenerative and metabolic syndrome pathologies. Cytokine Growth Factor Rev. 2015 Oct;26(5):507-15. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)