Ephrin-A2/EFNA2 Protein, Mouse (HEK293, His)

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with C-His labeled tag.

The Ephrin-A2/EFNA2 protein, a cell surface GPI-bound ligand for Eph receptors, is integral to neuronal, vascular, and epithelial development, where Eph receptors play a crucial role in migration, repulsion, and adhesion. EFNA2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. In association with the EPHA2 receptor, EFNA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis. This protein also binds to the receptor tyrosine kinases EPHA3, EPHA4, and EPHA5. Furthermore, EFNA2 interacts with EPHA8, activating this receptor and potentially influencing additional cellular processes. The multifaceted interactions of EFNA2 underscore its significance in orchestrating complex signaling events that impact diverse developmental and regulatory pathways.

Mouse

HEK293

C-His

P52801 (E23-N184)

13637  [NCBI]

Partial

EDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.