Ephrin-A2/EFNA2 Protein, Mouse (HEK293, His)
Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Ephrin-A2/EFNA2 protein, a cell surface GPI-bound ligand for Eph receptors, is integral to neuronal, vascular, and epithelial development, where Eph receptors play a crucial role in migration, repulsion, and adhesion. EFNA2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. In association with the EPHA2 receptor, EFNA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis. This protein also binds to the receptor tyrosine kinases EPHA3, EPHA4, and EPHA5. Furthermore, EFNA2 interacts with EPHA8, activating this receptor and potentially influencing additional cellular processes. The multifaceted interactions of EFNA2 underscore its significance in orchestrating complex signaling events that impact diverse developmental and regulatory pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P52801 (E23-N184)
-
Molecular Construction
-
N-term
-
EFNA2 (E23-N184)
Accession # P52801 -
His
-
C-term
-
-
Protein Length
Full Length of Ephrin-A2 Chain
-
Synonyms
EFNA2; ELF-1; Prev. EPLG6; HEK7-L; LERK6; LERK-6; EPH-Related Receptor Tyrosine Kinase Ligand 6; Ephrin-A2 [Amino Acids 176-213]; Ephrin-A2; Ephrin A2; HEK7 Ligand
-
AA Sequence
EDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
