Copy Link Print Information

Ephrin-A2/EFNA2 Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Ephrin-A2/EFNA2 Protein, Mouse (HEK293)
  • Experimental Validation Results for Ephrin-A2/EFNA2 Protein, Mouse (HEK293)
  • Ephrin-A2/EFNA2 Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with tag free.

Background

The Ephrin-A2/EFNA2 protein, a cell surface GPI-bound ligand for Eph receptors, is integral to neuronal, vascular, and epithelial development, where Eph receptors play a crucial role in migration, repulsion, and adhesion. EFNA2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. In association with the EPHA2 receptor, EFNA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis. This protein also binds to the receptor tyrosine kinases EPHA3, EPHA4, and EPHA5. Furthermore, EFNA2 interacts with EPHA8, activating this receptor and potentially influencing additional cellular processes. The multifaceted interactions of EFNA2 underscore its significance in orchestrating complex signaling events that impact diverse developmental and regulatory pathways.

Verified Bioactivity

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P52801 (R21-N184)

  • Gene ID
    13637  [NCBI]
  • Molecular Construction
    • N-term
    • EFNA2 (R21-N184)
      Accession # P52801
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    EFNA2; ELF-1; Prev. EPLG6; HEK7-L; LERK6; LERK-6; EPH-Related Receptor Tyrosine Kinase Ligand 6; Ephrin-A2 [Amino Acids 176-213]; Ephrin-A2; Ephrin A2; HEK7 Ligand

  • AA Sequence

    RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN

  • Predicted Molecular Mass

    18.9 kDa

  • Molecular Weight

    Approximately 24-26 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×105 units/mg.

  • Ephrin-A2/EFNA2 Protein, Mouse (HEK293) Product Image
    1/16
  • Experimental Validation Results for Ephrin-A2/EFNA2 Protein, Mouse (HEK293)
  • Experimental Validation Results for Ephrin-A2/EFNA2 Protein, Mouse (HEK293)
  • Ephrin-A2/EFNA2 Protein, Mouse (HEK293) Product Image