GCP-2/CXCL6 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CXCL6 (also known as granulocyte chemotactic protein-2, GCP-2), a member of the ELR+ CXC chemokine family, is a chemoattractant for neutrophilic granulocytes and initiates chemotaxis through the chemokine receptors CXCR1 and CXCR2. CXCL6 exerts neutrophil-activating and angiogenic activities, and has antibacterial action against Gram-negative and Gram-positive bacteria. GCP-2/CXCL6 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (G38-N114).
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CXCL6 (also known as granulocyte chemotactic protein-2, GCP-2), a member of the ELR+ CXC chemokine family, is a chemoattractant for neutrophilic granulocytes and initiates chemotaxis through the chemokine receptors CXCR1 and CXCR2[1][2]. CXCL6 exerts neutrophil-activating and angiogenic activities, and has antibacterial action against Gram-negative and Gram-positive bacteria[3]. GCP-2/CXCL6 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (G38-N114).
Background
CXCL6 (also known as GCP-2) is a CXC chemokine expressed by macrophages and epithelial and mesenchymal cells during inflammation. Through binding and activation of its receptors (CXCR1 and CXCR2), it exerts neutrophil-activating and angiogenic activities. In addition, CXCL6 also has antibacterial effects[1][3].
CXCL6 is an ELR-positive CXC chemokine with a length of 77 amino acids. The NH2-terminal glutamic acid-leucine-arginine (ELR) motif is characteristic of CXC chemokines interacting with the G-protein-coupled receptors CXCR1 and CXCR2. The ELR+ CXC family which includes IL-8, the growth-regulated oncogenes (GRO-α,-β-γ), and ENA-78. The structure of CXCL6 is >75% homologous to ENA-78, but is unique in that it binds with high-affinity to both CXCR1 and CXCR2. GCP-2, similar to IL-8, activates target cells by binding to CXCR-1 and CXCR-2. Both receptors are expressed by neutrophil granulocytes, but not by other blood-derived cells, such as lymphocytes or monocytes. Activation of endothelial cells by CXCL6 causes a mitogenic response, resulting in angiogenesis. CXCL2 is expressed by epithelial cells of the airways, eyes, gastrointestinal tract, mammary glands, tonsils, macrophages, and mesenchymal cells, in particular during inflammation. Lipopolysaccharides (LPS) and the proinflammatory cytokines TNF-α and IL-1β up-regulate the expression of CXCL6, while gamma interferon has a down-regulating effect[1][2][3].
CXCL6 mediates several processes such as inflammation, immunoreaction, cell growth, and metastasis through interaction with the chemokine receptors CXCR1 and CXCR2 in humans. CXCL6 possesses potent chemotactic and proangiogenic properties. CXCL6 is over expressed in colorectal, breast, lung and thyroid cancers. In addition, CXCL6 shows antibacterial activity against gram-positive and gram-negative pathogenic bacteria of relevance to mucosal infections is seen at submicromolar concentrations[1][2][3].
In Vitro
Recombinant CXCL6 (10 ng/mL) significantly inhibits both Sirt3 mRNA and protein levels, however, the AKT and FOXO3a phosphorylation significantly increased in human brain microvascular endothelial cells (HBMECs)[2].
Recombinant human CXCL6 (0 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 10 ng/mL; 72 h) elicites enhanced proliferation of HUVECs in a dose-dependent manner, and co-culture with fibroblasts caused significantly enhanced HUVEC proliferation. Recombinant CXCL6 also promotes the proliferation of HUVECs in a concentration-dependent manner[4].
Recombinant human CXCL6 (0 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 10 ng/mL; 24 h) significantly promotes cancer cell invasion in HT-29 cells[4].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P80162 (G38-N114)
-
Molecular Construction
-
N-term
-
CXCL6 (G38-N114)
Accession # P80162 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL6; Small-Inducible Cytokine B6; Prev. SCYB6; Chemokine Alpha 3; GCP-2; GCP2; CKA-3; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member B; Granulocyte Chemotactic Protein 2; Chemokine (C-X-C Motif) Ligand 6; Small Inducible Cytokine Subfamily B (
-
AA Sequence
GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
-
Predicted Molecular Mass
9.4 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% trehalose, 1 mM EDTA, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Pooja Mittal, et al. CXCL6 (granulocyte chemotactic protein-2): a novel chemokine involved in the innate immune response of the amniotic cavity. Am J Reprod Immunol. 2008 Sep;60(3):246-57. [Content Brief]
[2]. Xiaolin Wang, et al. CXCL6 regulates cell permeability, proliferation, and apoptosis after ischemia-reperfusion injury by modulating Sirt3 expression via AKT/FOXO3a activation. Cancer Biol Ther. 2021 Jan 2;22(1):30-39. [Content Brief]
[3]. Helena M Linge, et al. The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial. Antimicrob Agents Chemother. 2008 Jul;52(7):2599-607. [Content Brief]
[4]. Jia-Chi Ma, et al. Fibroblast-derived CXCL12/SDF-1α promotes CXCL6 secretion and co-operatively enhances metastatic potential through the PI3K/Akt/mTOR pathway in colon cancer. World J Gastroenterol. 2017 Jul 28;23(28):5167-5178. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)