GCP-2/CXCL6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CXCL6 (also known as granulocyte chemotactic protein-2, GCP-2), a member of the ELR+ CXC chemokine family, is a chemoattractant for neutrophilic granulocytes and initiates chemotaxis through the chemokine receptors CXCR1 and CXCR2. CXCL6 exerts neutrophil-activating and angiogenic activities, and has antibacterial action against Gram-negative and Gram-positive bacteria. GCP-2/CXCL6 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (G38-N114).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL6 (also known as granulocyte chemotactic protein-2, GCP-2), a member of the ELR+ CXC chemokine family, is a chemoattractant for neutrophilic granulocytes and initiates chemotaxis through the chemokine receptors CXCR1 and CXCR2[1][2]. CXCL6 exerts neutrophil-activating and angiogenic activities, and has antibacterial action against Gram-negative and Gram-positive bacteria[3]. GCP-2/CXCL6 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (G38-N114).

Background

CXCL6 (also known as GCP-2) is a CXC chemokine expressed by macrophages and epithelial and mesenchymal cells during inflammation. Through binding and activation of its receptors (CXCR1 and CXCR2), it exerts neutrophil-activating and angiogenic activities. In addition, CXCL6 also has antibacterial effects[1][3].
CXCL6 is an ELR-positive CXC chemokine with a length of 77 amino acids. The NH2-terminal glutamic acid-leucine-arginine (ELR) motif is characteristic of CXC chemokines interacting with the G-protein-coupled receptors CXCR1 and CXCR2. The ELR+ CXC family which includes IL-8, the growth-regulated oncogenes (GRO-α,-β-γ), and ENA-78. The structure of CXCL6 is >75% homologous to ENA-78, but is unique in that it binds with high-affinity to both CXCR1 and CXCR2. GCP-2, similar to IL-8, activates target cells by binding to CXCR-1 and CXCR-2. Both receptors are expressed by neutrophil granulocytes, but not by other blood-derived cells, such as lymphocytes or monocytes. Activation of endothelial cells by CXCL6 causes a mitogenic response, resulting in angiogenesis. CXCL2 is expressed by epithelial cells of the airways, eyes, gastrointestinal tract, mammary glands, tonsils, macrophages, and mesenchymal cells, in particular during inflammation. Lipopolysaccharides (LPS) and the proinflammatory cytokines TNF-α and IL-1β up-regulate the expression of CXCL6, while gamma interferon has a down-regulating effect[1][2][3].
CXCL6 mediates several processes such as inflammation, immunoreaction, cell growth, and metastasis through interaction with the chemokine receptors CXCR1 and CXCR2 in humans. CXCL6 possesses potent chemotactic and proangiogenic properties. CXCL6 is over expressed in colorectal, breast, lung and thyroid cancers. In addition, CXCL6 shows antibacterial activity against gram-positive and gram-negative pathogenic bacteria of relevance to mucosal infections is seen at submicromolar concentrations[1][2][3].

In Vitro

Recombinant CXCL6 (10 ng/mL) significantly inhibits both Sirt3 mRNA and protein levels, however, the AKT and FOXO3a phosphorylation significantly increased in human brain microvascular endothelial cells (HBMECs)[2].
Recombinant human CXCL6 (0 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 10 ng/mL; 72 h) elicites enhanced proliferation of HUVECs in a dose-dependent manner, and co-culture with fibroblasts caused significantly enhanced HUVEC proliferation. Recombinant CXCL6 also promotes the proliferation of HUVECs in a concentration-dependent manner[4].
Recombinant human CXCL6 (0 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 10 ng/mL; 24 h) significantly promotes cancer cell invasion in HT-29 cells[4].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL6 (G38-N114)
      Accession # P80162
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL6; Small-Inducible Cytokine B6; Prev. SCYB6; Chemokine Alpha 3; GCP-2; GCP2; CKA-3; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member B; Granulocyte Chemotactic Protein 2; Chemokine (C-X-C Motif) Ligand 6; Small Inducible Cytokine Subfamily B (

  • AA Sequence

    GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

  • Predicted Molecular Mass

    9.4 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% trehalose, 1 mM EDTA, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00