IFN-gamma Protein, Feline

Customer Review

Based on 1 Customer Validation

IFN-gamma (Interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, which can significantly activate antibacterial, antiviral and anti-tumor responses. Its main JAK-STAT signaling pathway is triggered by interaction with the receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Feline is the recombinant IFN-gamma protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IFN-gamma (Interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, which can significantly activate antibacterial, antiviral and anti-tumor responses. Its main JAK-STAT signaling pathway is triggered by interaction with the receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Feline is the recombinant IFN-gamma protein, expressed by E. coli , with tag free.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells such as T-cells and NK cells, assumes crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling occurs through the JAK-STAT pathway after interaction with its receptor IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain opens out, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1, leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors, such as IRF1, capable of further driving the regulation of a subsequent wave of transcription. IFN-gamma plays a role in the class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. It enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Additionally, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of several key molecules, such as cathepsins B/CTSB, H/CTSH, and L/CTSL, contributing to immune responses. Participating in the regulation of hematopoietic stem cells during development and under homeostatic conditions, IFN-gamma influences their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization, orchestrating its diverse and critical functions in immune responses and hematopoiesis.

Verified Bioactivity

1.Measured in an anti-viral assay using CRFK feline kidney epithelial cells infected with vesicular stomatitis virus (VSV). The ED50 for this effect is 0.15-0.9 ng/mL.
2.Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.1612 ng/mL, corresponding to a specificactivity is 6.203×106 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.1612 ng/mL, corresponding to a specificactivity is 6.203×106 Unit/mg.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-K167)
      Accession # P46402
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00