1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-10 Receptor
  5. IL-10R beta
  6. IL-10R beta Protein, Human (HEK293, His-hFc)

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Human (HEK293, His-hFc) is expressed by HEK293 cells and with a His and -hFc tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Human (HEK293, His-hFc) is expressed by HEK293 cells and with a His and -hFc tag at the C-terminus[3].

Background

IL-10 receptor complex consists of a heterodimer of four transmembrane chains, two of which form IL-10R alpha and two of which form IL-10R beta. IL-10R beta, originally known as the orphan receptor CRF2-4, is an essential accessory subunit for the active interleukin 10 receptor complex[1].
IL-10R beta can bind to IL-10 via the JAK-STAT pathway, and activation of the IL-10 receptor complex leads to phosphorylation of the receptor-associated proteins TYK and JAK-1, and ultimately to activation of the transcription factors STAT3, STAT1, and STAT5, which regulate the expression of IL-10-responsive genes, including c-myc, bcl-2, and bcl-xL, initiating signal transduction[2].
IL-10R beta is expressed on most cell types and is also a shared cell surface receptor required for the activation of five class II cytokines (IL-10, IL-22, IL-26, IL-28 and IFNL1), which play a key role in host defense, immune regulation. Among them, the IFNLR1/IL10R beta dimer is the receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity[3].

In Vitro

IL-1R beta expression levels increase steadily during neuronal differentiation in human neuronal cells (NT2-N) and can be co-expressed with IL-28Rα, affecting the biological function of cells for IFN-λ[4].

Biological Activity

Immobilized Recombinant Human IL 28 R alpha /IFN lambda R1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human IL-10R beta .The ED50 for this effect is 1.967 μg/mL.

  • Immobilized Recombinant Human IL 28 R alpha /IFN lambda R1 at 5 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human IL-10R beta .The ED50 for this effect is 1.967 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc;C-His

Accession

Q08334 (M20-S220)

Gene ID
Molecular Construction
N-term
IL-10Rβ (M20-S220)
Accession # Q08334
hFc-His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-10 receptor subunit beta; IL-10RB; CRF2-4; IL-10R2; CDw210b
AA Sequence

MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

Molecular Weight

75-85 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IL-10R beta Protein, Human (HEK293, His-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-10R beta Protein, Human (HEK293, His-hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10R beta Protein, Human (HEK293, His-hFc)
Cat. No.:
HY-P74839
Quantity:
MCE Japan Authorized Agent: