IL-17A Protein, Mouse (E. coli)
Based on 1 Customer Validation
IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.
Background
IL-17A Protein, an effector cytokine, plays a pivotal role in innate and adaptive immune responses, safeguarding host tissues against microbial threats. Signaling through the IL17RA-IL17RC receptor complex, it activates NF-kappa-B and MAPkinase pathways, orchestrating the transcriptional activation of immune effectors. As a hallmark Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. It acts as part of an inflammatory circuit, promoting bacterial clearance, and is crucial for epithelial barrier integrity during homeostasis and infection. IL-17A enhances antiviral defense and, in synergy with IL-17F, induces the production of antimicrobial peptides. Its homodimeric and heterodimeric structures highlight its diverse interactions in immune regulation.
Verified Bioactivity
Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2.306-4.085 ng/mL, corresponding to a specific activity is 2.45-4.34×105 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q62386 (T22-A158)
-
Gene ID16171
-
Molecular Construction
-
N-term
-
IL-17A (T22-A158)
Accession # Q62386 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc
-
AA Sequence
TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
-
Predicted Molecular Mass
15.4 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)