Copy Link Print Information

IL-17A Protein, Mouse (E. coli)

Customer Review

Based on 1 Customer Validation

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-17A Protein, Mouse (E. coli)
  • Experimental Validation Results for IL-17A Protein, Mouse (E. coli)
  • IL-17A Protein, Mouse (E. coli) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.

Background

IL-17A Protein, an effector cytokine, plays a pivotal role in innate and adaptive immune responses, safeguarding host tissues against microbial threats. Signaling through the IL17RA-IL17RC receptor complex, it activates NF-kappa-B and MAPkinase pathways, orchestrating the transcriptional activation of immune effectors. As a hallmark Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. It acts as part of an inflammatory circuit, promoting bacterial clearance, and is crucial for epithelial barrier integrity during homeostasis and infection. IL-17A enhances antiviral defense and, in synergy with IL-17F, induces the production of antimicrobial peptides. Its homodimeric and heterodimeric structures highlight its diverse interactions in immune regulation.

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2.306-4.085 ng/mL, corresponding to a specific activity is 2.45-4.34×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q62386 (T22-A158)

  • Gene ID
    16171
  • Molecular Construction
    • N-term
    • IL-17A (T22-A158)
      Accession # Q62386
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

  • Predicted Molecular Mass

    15.4 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 2.547 ng/mL, corresponding to a specific activity is 3.926×105 U/mg.

  • IL-17A Protein, Mouse (E. coli) Product Image
    1/16
  • Experimental Validation Results for IL-17A Protein, Mouse (E. coli)
  • Experimental Validation Results for IL-17A Protein, Mouse (E. coli)
  • IL-17A Protein, Mouse (E. coli) Product Image