IL-17A Protein, Rat (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat is the recombinant rat-derived IL-17A protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat is the recombinant rat-derived IL-17A protein, expressed by E. coli.

Background

IL-17A Protein is predicted to play a crucial role in protein heterodimerization and homodimerization activities. It is involved in various biological processes, including the cellular response to glucocorticoid stimulus, positive regulation of necrotic cell death, and positive regulation of transcription by RNA polymerase II. This protein is found in both the cytoplasm and extracellular space. IL-17A is implicated in numerous diseases, including acute necrotizing pancreatitis, inflammatory bowel disease, lipoid nephrosis, lung diseases, and periodontal diseases, serving as a biomarker for these conditions. It is also associated with specific ailments such as anti-basement membrane glomerulonephritis, congestive heart failure, myocarditis, pleurisy, and uveitis. Furthermore, IL-17A's human ortholog, interleukin 17A, is linked to diseases like Mycobacterium avium complex disease, autoimmune diseases, bronchial diseases, macular degeneration, and rhinitis. Despite its low expression in the reference dataset, IL-17A remains a key player in immune response and disease pathology.

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.7119 ng/mL, corresponding to a specific activity is 1.4×106 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 0.7119 ng/mL, corresponding to a specific activity is 1.4×106 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-17A (A26-S158)
      Accession # NP_001100367
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

  • Predicted Molecular Mass

    15 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00