Copy Link Print Information

KGF/FGF-7 Protein, Human (Biotinylated, His)

Customer Review

Based on 1 Customer Validation

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (Biotinylated, His) is the recombinant human-derived KGF/FGF-7 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (Biotinylated, His)
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (Biotinylated, His)
  • KGF/FGF-7 Protein, Human (Biotinylated, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (Biotinylated, His) is the recombinant human-derived KGF/FGF-7 protein, expressed by E. coli , with N-His labeled tag.

Background

KGF/FGF-7 Protein assumes a crucial role in orchestrating embryonic development, exhibiting regulatory control over fundamental processes encompassing cell proliferation and differentiation. Its essential contribution extends to the intricate realm of normal branching morphogenesis, where KGF/FGF-7 plays a pivotal role. As a growth factor specifically active on keratinocytes, it emerges as a potential major paracrine effector governing normal epithelial cell proliferation. The protein establishes key interactions, forming complexes with FGFBP1 and FGFR2, and its binding affinity with fibroblast growth factors (FGFs) and their receptors is augmented by heparan sulfate glycosaminoglycans, acting as critical coreceptors in these molecular interactions.

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr5 rhesus monkey epithelial cells. The ED50 for this effect is 6-60 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using 4MBr 5 rhesus monkey epithelial cells. The ED50 for this effect is 14.52 ng/mL, corresponding to a specific activity is 6.89×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-8*His
  • Accession

    P21781-1 (C32-T194)

  • Gene ID
    2252  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His
    • KGF/FGF-7 (C32-T194)
      Accession # P21781-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Conjugate Method

    The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

  • Synonyms

    FGF7; HBGF-7; Fibroblast Growth Factor 7; FGF-7; KGF; Fibroblast Growth Factor 7 (Keratinocyte Growth Factor); Keratinocyte Growth Factor; Fibroblast Growth Factor; Heparin-Binding Growth Factor 7; FGF

  • AA Sequence

    CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 250 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr 5 rhesus monkey epithelial cells. The ED50 for this effect is 14.52 ng/mL, corresponding to a specific activity is 6.89×104 units/mg.

  • KGF/FGF-7 Protein, Human (Biotinylated, His) Product Image
    1/16
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (Biotinylated, His)
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (Biotinylated, His)
  • KGF/FGF-7 Protein, Human (Biotinylated, His) Product Image