PRAK/MAPKAPK5 Protein, Human (Active, sf9, GST)
PRAK/MAPKAPK5 Protein, Human (sf9, GST) is the recombinant human-derived MAPKAPK5, expressed by Sf9 insect cells , with GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRAK/MAPKAPK5 Protein, Human (sf9, GST) is the recombinant human-derived MAPKAPK5, expressed by Sf9 insect cells , with GST labeled tag.
Background
MAPKAPK5 is a tumor suppressor serine/threonine-protein kinase involved in mTORC1 signaling and post-transcriptional regulation. It phosphorylates FOXO3, ERK3/MAPK6, ERK4/MAPK4, HSP27/HSPB1, p53/TP53, and RHEB. Acting as a tumor suppressor, MAPKAPK5 mediates Ras-induced senescence and phosphorylates p53/TP53. It also regulates MYC post-transcriptionally by phosphorylating FOXO3, which promotes FOXO3 nuclear localization and subsequent expression of miR-34b and miR-34c, two miRNAs that bind to the 3'UTR of MYC transcript and inhibit its translation. Additionally, MAPKAPK5 negatively regulates mTORC1 signaling by phosphorylating and inhibiting RHEB. Through its interaction with ERK3/MAPK6 or ERK4/MAPK4, MAPKAPK5 participates in atypical MAPK signaling: the exact role of the complex remains unclear, but it involves a cascade of phosphorylation events where ERK3/MAPK6 (or ERK4/MAPK4) is phosphorylated upon interaction, leading to MAPKAPK5 activation, which in turn phosphorylates ERK3/MAPK6 (or ERK4/MAPK4). In response to PKA/PRKACA stimulation, MAPKAPK5 phosphorylates HSP27/HSPB1, inducing F-actin rearrangement.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q8IW41-1 (S2-Q473)
-
Gene ID8550
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAPKAPK5; MAPKAP Kinase 5; MAPK Activated Protein Kinase 5; MAPKAP-K5; PRAK; MAPKAPK-5; MK5; MK-5; Mitogen-Activated Protein Kinase-Activated Protein Kinase 5; Non-Specific Serine/Threonine Protein Kinase; P38-Regulated/Activated Protein Kinase; MAPK-Acti
-
AA Sequence
SEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
