1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CAMK
  4. MAPK Family MAPKAPK
  5. MAPKAPK5/PRAK
  6. PRAK/MAPKAPK5 Protein, Human (Active, sf9, GST)

PRAK/MAPKAPK5 Protein, Human (Active, sf9, GST)

Cat. No.: HY-P702664
Handling Instructions Technical Support

PRAK/MAPKAPK5 Protein, Human (sf9, GST) is the recombinant human-derived MAPKAPK5, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRAK/MAPKAPK5 Protein, Human (sf9, GST) is the recombinant human-derived MAPKAPK5, expressed by Sf9 insect cells , with GST labeled tag.

Background

MAPKAPK5 is a tumor suppressor serine/threonine-protein kinase involved in mTORC1 signaling and post-transcriptional regulation. It phosphorylates FOXO3, ERK3/MAPK6, ERK4/MAPK4, HSP27/HSPB1, p53/TP53, and RHEB. Acting as a tumor suppressor, MAPKAPK5 mediates Ras-induced senescence and phosphorylates p53/TP53. It also regulates MYC post-transcriptionally by phosphorylating FOXO3, which promotes FOXO3 nuclear localization and subsequent expression of miR-34b and miR-34c, two miRNAs that bind to the 3'UTR of MYC transcript and inhibit its translation. Additionally, MAPKAPK5 negatively regulates mTORC1 signaling by phosphorylating and inhibiting RHEB. Through its interaction with ERK3/MAPK6 or ERK4/MAPK4, MAPKAPK5 participates in atypical MAPK signaling: the exact role of the complex remains unclear, but it involves a cascade of phosphorylation events where ERK3/MAPK6 (or ERK4/MAPK4) is phosphorylated upon interaction, leading to MAPKAPK5 activation, which in turn phosphorylates ERK3/MAPK6 (or ERK4/MAPK4). In response to PKA/PRKACA stimulation, MAPKAPK5 phosphorylates HSP27/HSPB1, inducing F-actin rearrangement.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q8IW41-1 (S2-Q473)

Gene ID

8550

Protein Length

Partial

Synonyms
MAPKAPK5; MAPK activated protein kinase 5; MK5; MK-5; NCFD; PRAK; MAPKAP-K5
AA Sequence

SEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRAK/MAPKAPK5 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRAK/MAPKAPK5 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P702664
Quantity:
MCE Japan Authorized Agent: