MCP-2/CCL8 Protein, Human (SUMO)

MCP-2/CCL8 Protein, Human (SUMO) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human (SUMO) is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by E. coli  with a N-SUMO tag^[1][2].

CCL8, also known as monocyte chemotactic protein 2 ( MCP2), is a small cell factor belonging to the CC chemokine family. First identified in human osteosarcoma cells, it is a protein encoded by the CCL8 gene located on human chromosome 17. CCL8 is mainly expressed in small intestine and peripheral blood cells. CCL8 can bind to several different chemokine cell surface receptors, such as CCR1, CCR2B, CCR3 and CCR5. CCL8 can act as a chemoattractant, attracting chemokines such as monocytes, lymphocytes, basophils and eosinophils to mediate inflammatory host responses. On the one hand, CCL8 contributes to the spread of breast cancer and promotes the migration and invasion of esophageal squamous cell carcinoma. On the other hand, it has also been reported that CCL8 inhibits cervical cancer tumor growth and exhibits anti-tumor metastatic effects in melanoma. cCL8 significantly activates ERK1/2 phosphorylation in glioblastoma cells and significantly reduces the invasiveness of glioma cells by neutralizing antibody blockade of tama-secreted CCL8. At the same time, CCL8 can act as a potent HIV1 inhibitor with high affinity for the receptor CCR5, which is one of the major co-receptors for HIV1^[1][2].

MCP2/CCL8 (1 ng/mL, 48 h) can induce Epithelial-Mesenchymal Transition (EMT) by activation NF-κB signal pathway in human ESCC cell line Eca19 and promote migration and invasion of ESCC cells^[3].

Human

E. coli

N-SUMO

P80075 (Q24-P99)

6355  [NCBI]

Full Length of Mature Protein

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Approximately 30 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100(4):619-629.  [Content Brief]

  [2]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412.  [Content Brief]

  [3]. Jian Zhou, et al. MCP2 activates NF-κB signaling pathway promoting the migration and invasion of ESCC cells. Cell Biol Int. 2018 Mar;42(3):365-372.  [Content Brief]