1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 alpha/CCL20
  6. MIP-3 alpha/CCL20 Protein, Mouse (sf9, His)

MIP-3 alpha/CCL20 Protein, Mouse (sf9, His) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse (sf9, His) is a recombinant mouse CCL20 expressed by Sf9 insect cells with a his tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-3 alpha/CCL20 Protein, Mouse (sf9, His) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse (sf9, His) is a recombinant mouse CCL20 expressed by Sf9 insect cells with a his tag at the C-terminus[1].

Background

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation[1][2].

In Vitro

CCL2 is preferentially released into the apical chamber in polarized BALB/c mouse uterine epithelial cells. In contrast, in rats, it is preferentially released into the basolateral compartment[3].

In Vivo

CCL2 (s.c., .5 μg in 1 μL 1×PBS, every week, 21 days or 28 days) recruits a large number of GFP+ Treg cells to the tumor, and the tumor size of the mice is also significantly increased compared to the PBS control in B6.Cg-Foxp3 tm2Tch/J mice[4].

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

O89093 (A28-M97)

Gene ID
Molecular Construction
N-term
CCL20 (A28-M97)
Accession # O89093
His
C-term
Protein Length

Full Length

Synonyms
C-C motif chemokine 20; MIP3A; SCYA20
AA Sequence

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Predicted Molecular Mass
9.3 kDa
Molecular Weight

Approximately 14 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

MIP-3 alpha/CCL20 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MIP-3 alpha/CCL20 Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 alpha/CCL20 Protein, Mouse (sf9, His)
Cat. No.:
HY-P73813
Quantity:
MCE Japan Authorized Agent: