1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PARP14 Protein, Human

The PARP14 protein is an ADP-ribosyltransferase that uniquely mono-ADP-ribosylates glutamic acid residues on target proteins such as STAT1 and STAT6, unlike PARP1 and PARP2. It catalyzes STAT1 mono-ADP ribosylation at “Glu-657” and “Glu-705”, reduces STAT1 phosphorylation and inhibits the production of pro-inflammatory cytokines in macrophages following IFNG stimulation. PARP14 Protein, Human is the recombinant human-derived PARP14 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PARP14 protein is an ADP-ribosyltransferase that uniquely mono-ADP-ribosylates glutamic acid residues on target proteins such as STAT1 and STAT6, unlike PARP1 and PARP2. It catalyzes STAT1 mono-ADP ribosylation at “Glu-657” and “Glu-705”, reduces STAT1 phosphorylation and inhibits the production of pro-inflammatory cytokines in macrophages following IFNG stimulation. PARP14 Protein, Human is the recombinant human-derived PARP14 protein, expressed by E. coli , with tag free.

Background

PARP14 Protein, an ADP-ribosyltransferase, facilitates the mono-ADP-ribosylation of glutamate residues on target proteins, distinguishing itself from PARP1 and PARP2 by its inability to mediate poly-ADP-ribosylation. Specifically, it has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', leading to decreased STAT1 phosphorylation and subsequent negative regulation of pro-inflammatory cytokine production in macrophages following IFNG stimulation. However, the exact role of ADP-ribosylation in preventing STAT1 phosphorylation has been debated, with suggestions that the inhibition may be a result of STAT1 'Lys-703' sumoylation. Additionally, PARP14 mono-ADP-ribosylates STAT6, enhancing STAT6-dependent transcription, and in macrophages, it positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Furthermore, PARP14 engages in mono-ADP-ribosylation of PARP9.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q460N5 (F1208-E1387)

Gene ID

54625

Molecular Construction
N-term
PARP14 (F1208-E1387)
Accession # Q460N5
C-term
Protein Length

Partial

Synonyms
PARP14; Protein mono-ADP-ribosyltransferase PARP14; ADP-ribosyltransferase diphtheria toxin-like 8; ARTD8; B aggressive lymphoma protein 2; Poly [ADP-ribose] polymerase 14; PARP-14
AA Sequence

FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKRE

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PARP14 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PARP14 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PARP14 Protein, Human
Cat. No.:
HY-P701951
Quantity:
MCE Japan Authorized Agent: