1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL28
  6. MEC/CCL28 Protein, Human

MEC/CCL28 Protein, Human

Cat. No.: HY-P7250
COA Handling Instructions

MEC/CCL28 Protein, Human is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Human is a recombinant human MEC/CCL28(S20-Y127) protein expressed by E. coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MEC/CCL28 Protein, Human is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Human is a recombinant human MEC/CCL28(S20-Y127) protein expressed by E. coli[1][2].

Background

CCL28, also known as mucosal associated epithelial chemokine (MEC), CCK1, and SCYA28, is a chemokine. It is expressed in various mucosal sites, including salivary glands and mammary glands, trachea and colon, and small intestine. CCL28 has been classified as an important component chemokine in homeostasis lymphocyte transport and can bind to CCR3 and CCR10. Among them, CCL28 can chemotactic CCR10 expression of CD4 and CD8 T cell populations, as well as CCR3 expression of eosinophils migration. However, in the intestinal mucosa, few T cells express CCR10. In contrast, in the B-cell population, CCR10 can be selectively expressed by IgA plasma mother cells and IgA-secreting cells (i.e. plasma cells), which play a key role in homing plasma mother cells to extraintestinal effector sites[1]. CCL28 is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products that play a role in effector cell recruitment to sites of epithelial injury.CCL28 can act as a unifying immunostimulant on the mucosal surface and is involved in the migration of IgA-expressing cells to the breast, salivary glands, intestine, and other mucosal tissues. In addition, CCL28 exhibits broad-spectrum antimicrobial activity against Gram-negative and Gram-positive bacteria as well as fungi, such as Pseudomonas aeruginosa and Klebsiella pneumoniae. Further studies also showed that the positively charged amino acids at the C-terminal end of CCL28 significantly contributed to the antibacterial activity of the protein, and its characteristic hydrophobicity and amphiphilicity also contributed to its killing activity[2].

In Vitro

CCL28 (human; 100 ng/mL, 48 h) has no effect on DSC growth, but promotes decidual stromal cells (DSCs) apoptosis, and blocking CCL28-CCR3/CCR10 signaling can inhibit CCL28-induced apoptosis[3].
CCL28 (5, 2.5, 1.2 μg/mL, 2.5 h) can induce migration of IgA-secreting cells and IgA+ memory B cells from human H. pylori-infected tissues[4].

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 1.0-10.0 ng/ml.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NRJ3 (S20-Y127)

Gene ID
Synonyms
rHuMEC/CCL28; C-C motif chemokine 28; SCYA28
AA Sequence

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Molecular Weight

Approximately 12.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 130 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MEC/CCL28 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MEC/CCL28 Protein, Human
Cat. No.:
HY-P7250
Quantity:
MCE Japan Authorized Agent: