1. Recombinant Proteins
  2. MEC/CCL28 Protein, Human

MEC/CCL28 Protein, Human

Cat. No.: HY-P7250
Handling Instructions

MEC/CCL28 Protein, Human is a CC chemokine, which plays a key role in the segregation and the compartmentalization of the mucosal immune system through recruitment of immune cells to specific locations.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuMEC/CCL28; C-C motif chemokine 28; SCYA28
Species

Human

Source

E. coli

Accession

Q9NRJ3 (S20-Y127)

Gene ID

56477

Molecular Weight

Approximately 12.4 kDa

AA Sequence

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 1.0-10.0 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 130 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human MEC/CCL28 is a CC chemokine primarily expressed in thymic dendritic cells and mucosal epithelial cells, and plays a key role in the segregation and the compartmentalization of the mucosal immune system through recruitment of immune cells to specific locations. CCL28 also called mucosae-associated epithelial chemokine (MEC), is expressed in most human, mouse and pig mucosal tissues including the salivary gland, mammary gland (MG), small and large intestines and trachea, where it appears to be predominantly produced by epithelial cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MEC/CCL28 Protein, Human
Cat. No.:
HY-P7250
Quantity:
MCE Japan Authorized Agent: