1. Recombinant Proteins
  2. Receptor Proteins
  3. TSLP R Protein, Mouse (HEK293, Fc)

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL). TSLP R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)[1][2]. TSLP R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for thymic stromal lymphopoietin (TSLP). Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway (STAT3 and STAT5). Crlf2 usually upregulated and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)[1][2].

Biological Activity

Mouse TSLP R-Fc on Protein A Biosensor can bind Human TSLP with an affinity constant of 67.3 nM.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

AAH23788.1 (A20-L233)

Gene ID
Molecular Construction
N-term
TSLP R (A20-L233)
Accession # AAH23788.1
hFc
C-term
Protein Length

Partial

Synonyms
CRL2; CRLF2; CRL2 cytokine receptor; cytokine receptor-like factor 2; ILXR; IL-XR; P2RY8/CRLF2 fusion; Thymic stromal lymphopoietin protein receptor; Thymic stromal-derived lymphopoietin receptor; TSLP receptor; TSLPR
AA Sequence

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

분자량

62-88 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

TSLP R Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TSLP R Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TSLP R Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70823
수량:
MCE Japan Authorized Agent: