TSLP Receptor Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL). TSLP Receptor Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP Receptor protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)[1][2]. TSLP Receptor Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP Receptor protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for thymic stromal lymphopoietin (TSLP). Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway (STAT3 and STAT5). Crlf2 usually upregulated and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL)[1][2].
Verified Bioactivity
Mouse TSLP R-Fc on Protein A Biosensor can bind Human TSLP with an affinity constant of 67.3 nM.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
AAH23788.1 (A20-L233)
-
Molecular Construction
-
N-term
-
TSLP R (A20-L233)
Accession # AAH23788.1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CRLF2; IL-XR; Cytokine Receptor Like Factor 2; Thymic Stromal-Derived Lymphopoietin Receptor; TSLPR; Cytokine Receptor CRL2 Precusor; CRL2; Cytokine Receptor-Like 2; Thymic Stromal Lymphopoietin Protein Receptor; CRLF2Y; Cytokine Receptor-Like Factor 2; P
-
AA Sequence
AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL
-
Predicted Molecular Mass
49.8 kDa
-
Molecular Weight
Approximately 62-88 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)