TSLP Protein, Mouse (HEK293, Fc)

Immobilized Mouse TSLP at 0.5 μg/mL (100 μL/well) can bind Monoclonal Anti-Human TSLP Antibody. The ED₅₀ of TSLP protein is 3.789 μg/mL, corresponding to a specific activity is 2.64×10⁵ units/mg.

• 
  Immobilized Mouse TSLP at 0.5 μg/mL (100 μL/well) can bind Monoclonal Anti-Human TSLP Antibody. The ED₅₀ of TSLP protein is 3.789 μg/mL, corresponding to a specific activity is 2.64×10⁵ units/mg.

Mouse

HEK293

C-hFc

Q9JIE6 (Y20-E140)

53603  [NCBI]

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

42-58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.