Copy Link Print Information

TSLP Protein, Mouse (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TSLP Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for TSLP Protein, Mouse (HEK293, Fc)
  • TSLP Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TSLP (thymic stromal lymphopoietin) protein is a cytokine with diverse immunomodulatory functions. It induces the release of T-cell-attracting chemokines from monocytes and promotes the maturation of CD11c(+) dendritic cells, playing a crucial role in the regulation of immune responses. TSLP is known to have implications in allergic inflammation by directly activating mast cells, contributing to the complex network of allergic responses. TSLP exerts its effects by interacting with a receptor complex composed of CRLF2 and IL7R, and the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for recruiting IL7R to form the high-affinity ternary complex. These interactions highlight the intricate molecular mechanisms through which TSLP influences immune cell behavior, emphasizing its role in immune system regulation and allergic responses.

Verified Bioactivity

1.Immobilized Mouse TSLP at 0.5 μg/mL (100 μL/well) can bind Monoclonal Anti-Human TSLP Antibody. The ED50 of TSLP protein is 3.789 μg/mL, corresponding to a specific activity is 2.64×105 units/mg.
2.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with mouse IL-7RA. The ED50 for this effect is 1.967 ng/mL. Corresponding to a specific activity is 5.084×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Mouse TSLP at 0.5 μg/mL (100 μL/well) can bind Monoclonal Anti-Human TSLP Antibody. The ED50 of TSLP protein is 3.789 μg/mL, corresponding to a specific activity is 2.64×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q9JIE6 (Y20-E140)

  • Gene ID
    53603  [NCBI]
  • Molecular Construction
    • N-term
    • TSLP (Y20-E140)
      Accession # Q9JIE6
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP

  • AA Sequence

    YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

  • Predicted Molecular Mass

    41.4 kDa

  • Molecular Weight

    Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Mouse TSLP at 0.5 μg/mL (100 μL/well) can bind Monoclonal Anti-Human TSLP Antibody. The ED50 of TSLP protein is 3.789 μg/mL, corresponding to a specific activity is 2.64×105 units/mg.

  • TSLP Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for TSLP Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for TSLP Protein, Mouse (HEK293, Fc)
  • TSLP Protein, Mouse (HEK293, Fc) Product Image