- Signaling Pathways
- Metabolic Enzyme/Protease
- Angiotensin-converting Enzyme (ACE)
Angiotensin-converting Enzyme (ACE)
All Product Categories
-
Angiotensin-converting Enzyme (ACE) Inhibitors
(284)
View all products
-
Angiotensin-converting Enzyme (ACE) Antagonist
(1)
View all products
-
Angiotensin-converting Enzyme (ACE) Activators
(5)
View all products
-
Angiotensin-converting Enzyme (ACE) Modulator
(1)
View all products
-
Angiotensin-converting Enzyme (ACE) Chemical
(1)
View all products
-
Angiotensin-converting Enzyme (ACE) Control
(1)
View all products
-
Angiotensin-converting Enzyme (ACE) Substrates
(2)
View all products
-
ACE/CD143 Proteins
(1)
View all products
-
Angiotensin-Converting Enzyme 2 (ACE2) Proteins
(21)
View all products
-
Angiotensin-converting Enzyme (ACE) Related Products (341)
Related Products (341)
-
Recombinant Proteins (22)
-
Antibodies (3)
-
Moveltipril
0 ImagesSynonyms: Moveltipril calcium; MC-838Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Benazeprilat-d5
0 ImagesCat. No.: HY-118472SCAS No.: 1279033-05-4Benazeprilat-d5 is the deuterium labeled Benazeprilat. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Spirapril hydrochloride
0 ImagesSynonyms: SCH 33844 hydrochlorideSpirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
0 ImagesCat. No.: HY-P3142NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Ramiprilat (Standard)
0 ImagesCat. No.: HY-A0115RCAS No.: 87269-97-4Synonyms: HOE 498 diacid (Standard); Ramipril diacid (Standard)Alvimopan (dihydrate) (Standard) is the analytical standard of Alvimopan (dihydrate). This product is intended for research and analytical applications. Alvimopan dihydrate (ADL 8-2698 dihydrate) is a potent, selective, orally active and reversible μ-opioid receptor antagonist, with an IC50 of 1.7 nM. Alvimopan dihydrate has selectivity for μ-opioid receptor (Ki=0.47 nM) over κ- and δ-opioid receptors (Kis=100, 12 nM, respectively). Alvimopan dihydrate can be used for the research of postoperative ileus. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Bradykinin potentiator B
0 ImagesSynonyms: Bradykinin potentiating peptide BBradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
ACE2 Human Pre-designed siRNA Set A
0 ImagesCat. No.: HY-RS00152ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Perindoprilat-d4
0 ImagesPerindoprilat-d4 is the deuterium labeled Perindoprilat. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Hemorphin-7
0 ImagesCat. No.: HY-P0318CAS No.: 152685-85-3Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Peimisine hydrochloride
0 ImagesSynonyms: Ebeiensine hydrochloride -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Rentiapril
0 ImagesSynonyms: SA-446Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
αs1-CN f(143–149) acetate
0 ImagesCat. No.: HY-P10601APurity: 99.32%αs1-CN f(143–149) acetate is an orally active casein-derived peptide sequence. αs1-CN f(143–149) acetate exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC50=6.58 μM) and antihypertensive activity. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Leucosceptoside A
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
HD5 TFA
0 ImagesCat. No.: HY-P5407AHD5 TFA is an innate immune effector peptide and SARS-CoV Inhibitor. HD5 TFA binds to the ligand-binding domain of angiotensin-converting enzyme-2 (ACE2) via multiple hydrogen bonds to competitively block the receptor, shielding it from viral recognition. HD5 TFA can be used for the research of COVID-19, HPV16 infection, epithelial ovarian cancer, small-cell lung cancer, and colon cancer. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Zofenopril-d5
0 ImagesCat. No.: HY-108321SPurity: 99.92%Zofenopril-d5 is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Diminazene
0 ImagesCat. No.: HY-W342283CAS No.: 536-71-0Diminazene is an antiparasitic agent widely used to treat parasitic diseases caused by hemoparasites (such as trypanosomes and babesia). Diminazene acts as an ACE2 activator and exerts cardiovascular protective effects by activating the ACE2/Ang-(1-7)/Mas receptor axis. By regulating gut microbiota-tryptophan metabolism, Diminazene inhibits the activation of core inflammatory signaling pathways including MAPK, STAT and NF-κB, increases central 5-HT levels, and suppresses splenic TNF-α production, thereby alleviating systemic inflammation. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Icariside D2
0 ImagesIcariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis . -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Pivalopril
0 ImagesSynonyms: Pivopril; RHC 3659(S)Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
0 ImagesLactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
0 ImagesCat. No.: HY-P3141STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results