1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL9
  6. MIG/CXCL9 Protein, Mouse (HEK293, His)

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE MIG/CXCL9 Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Background

CXCL9 is a member of the CXC family and has an important role in the chemotaxis of immune cells. It is secreted by various cell types including immune cells (T lymphocytes, NK cells, dendritic cells, macrophages, eosinophils, etc.), and non-immune cells (hepatic stellate cells, preadipocytes, thyrocytes, endothelial cell, tumor cells, and fibroblasts, etc)[1].
The amino acid sequence of human CXCL9 protein has low homology between mouse and rat CXCL9 protein.
CXCL9 is one of the ligands of chemokine receptor CXCR3 that mediates the infiltration of lymphocytes to focal sites and suppresses tumor growth. CXCL9 attracts CXCR3- (CXCR3-A and CXCR3-B) T lymphocytes, is involved in the pathogenesis of a variety of physiologic diseases during their initiation and their maintenance. The transcriptional regulation of CXCL9 is a multistep process involving many transcription factors, of which STAT1 and NF-κB are two most well-characterized members. Both the gene mutation of STAT1 and the blocking of the JA/STAT1 pathway can reduce CXCL9 expression induced by IFN-γ. Moreover, CXCL9 expression can be suppressed by reducing the levels of components of the STAT1-IRF-1 transcriptional activation pathway by Porphyromonas gingivalis that leads to the immune function decline. Lipopolysaccharide (LPS) and D-galactosamine could induce the phosphorylation of STAT1 and enhance the transcription of CXCL9 leading to the enhancement of liver inflammation, and even liver apoptosis and injury[1][2][3].
CXCL9 could promote cancer metastasis via enhanced migration and invasion of tumor cells, and breaking of the endothelial cells monolayer. However, as a tumor suppressor, it mainly recruited tumor-infiltrating CD8+ T cells and NK cells, and inhibited tumor angiogenesis. In Addition, IL-12 and Th1-derived IFN-γ exerted antitumor effects through the inhibitory effects of endogenous CXCL9 on tumor vasculature in human Burkitt's lymphoma. In cutaneous T-cell lymphoma, expression of CXCL9 was found at early stage but low at advanced stage. CXCL9 is also associated with human hepatic fibrosis and anti-fibrosis in mice. Furthermore, CXCL9 is highly expressed in atherosclerotic plaques of coronary arteries and specifically recruits CXCR3-bearing Th1 cells that increase the risk of plaque progression and the occurrences of myocardial infarction[1][2][3][4].

In Vitro

Recombinant mouse CXCL9 (10 mg/kg; for 4 weeks) is intraperitoneally injected three times a week in the orthotopic murine pancreatic adenocarcinoma (PAAD) model. CXCL9 could significant accelerate the growth of PAAD tumour. CXCL9 promotes PAAD progression and suppresses CD8+ cytotoxic T cells in tumour tissues[4].

In Vivo

Recombinant mouse CXCL9 (100 ng/mL) displays strong antiproliferative and antimigratory effects on VEGF-stimulated endothelial cells and stellate cells by way of reduced VEGFR2 (KDR), phospholipase Cγ (PLCγ), and extracellular signal-regulated kinase (ERK) phosphorylation[5].

Biological Activity

1.Measured by its ability to chemoattract THP-1 human peripheral blood T-lymphocytes. The ED50 for this effect is 85.56 ng/mL, corresponding to a specific activity is 1.169×104 U/mg.
2. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Mouse CXCR3. The ED50 for this effect is 0.1-0.3 μg/mL.

  • Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Mouse CXCR3. The ED50 for this effect is 0.1845 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P18340 (T22-T126)

Gene ID
Molecular Construction
N-term
CXCL9 (T22-T126)
Accession # P18340
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuC-X-C motif chemokine 9/CXCL9, His; C-X-C motif chemokine 9; Gamma-interferon-induced monokine; Monokine induced by interferon-gamma; MIG; MuMIG; Protein m119; Small-inducible cytokine B9; Cxcl9; Mig; Scyb9
AA Sequence

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Predicted Molecular Mass
12.2 kDa
분자량

Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

MIG/CXCL9 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

MIG/CXCL9 Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
MIG/CXCL9 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70008
수량:
MCE Japan Authorized Agent: