NRG1-beta 1 Protein, Human

NRG1-beta 1 Protein, a specific ligand for ERBB3, belongs to a family of structurally related polypeptide growth factors. NRG1-beta 1 Protein can regulate cell proliferation, differentiation, apoptosis and migration. NRG1-beta 1 Protein plays an important role in tumors and neurological diseases, and also has certain neuroprotective activity. NRG-1 Protein, Human is a recombinant NRG1-beta 1 protein expressed by E. coli without tags^{[1][2][3][4][5]}.

NRG1-beta 1 has an epidermal growth factor-like domain. As a ligand for ErbB3, NRG1-beta 1 can induce the formation of ErbB2-ErbB3 (HER2-HER3) heterodimers, thereby activating downstream signaling pathways such as PI3K/AKT and MAPK. NRG1-beta 1 promotes tumor cell survival, migration and invasion. NRG1-beta 1 also participates in processes such as neuronal migration, proliferation, differentiation and synaptic establishment^{[1][2][3][4][5]}.

NRG1-beta 1 Protein (Human; 40 ng/mL; 12 h) can inhibit DEPTOR protein levels in MCF7 and MDA-MB-361 cells^[4].

NRG1-beta 1 Protein (Human; 0.05-1 μg/kg; intravenous injection; 7 days) has a protective effect in a mouse model of photothrombotic ischemia, reducing cerebral infarction, restoring forelimb function, and promoting the proliferation and differentiation of neurons and oligodendrocytes^[5].

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×10⁵ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED₅₀ this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×10⁵ units/mg.

Human

E. coli

Tag Free

Q02297-6 (S177-E241)

3084  [NCBI]

Partial

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Asrani K, et al. The HER2- and heregulin β1 (HRG)-inducible TNFR superfamily member Fn14 promotes HRG-driven breast cancer cell migration, invasion, and MMP9 expression. Mol Cancer Res. 2013 Apr;11(4):393-404.  [Content Brief]

  [2]. Curley MD, et al. Seribantumab, an Anti-ERBB3 Antibody, Delays the Onset of Resistance and Restores Sensitivity to Letrozole in an Estrogen Receptor-Positive Breast Cancer Model. Mol Cancer Ther. 2015 Nov;14(11):2642-52.  [Content Brief]

  [3]. Yao YL, et al. Proliferation of colorectal cancer is promoted by two signaling transduction expression patterns: ErbB2/ErbB3/AKT and MET/ErbB3/MAPK. PLoS One. 2013 Oct 30;8(10):e78086.  [Content Brief]

  [4]. Bi Y, et al. Nuclear ErbB2 represses DEPTOR transcription to inhibit autophagy in breast cancer cells. Cell Death Dis. 2021 Apr 14;12(4):397.  [Content Brief]

  [5]. Cui MY, et al. Neuregulin-1/PI3K signaling effects on oligodendrocyte proliferation, remyelination and behaviors deficit in a male mouse model of ischemic stroke. Exp Neurol. 2023 Apr;362:114323.  [Content Brief]