Copy Link Print Information

IFN-gamma Protein, Human (CHO)

8 Cited Publications
Customer Review

Based on 8 publication(s) in Google Scholar

IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • IFN-gamma Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

Background

Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].

Verified Bioactivity

1.The ED50 is <2 ng/mL as measured in a cytotoxicity assay using HT-29 cells, corresponding to a specific activity of >5 × 105 units/mg.
2.Measured in antiviral assays using WISH cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 0.02-0.2 ng/mL.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P01579 (Q24-Q166)

  • Gene ID
    3458  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-Q166)
      Accession # P01579
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

  • Molecular Weight

    Approximately 15-25 kDa under reduced (R) conditions, 21 kDa & kDa under non reducing (N) conditions, based on SDS-PAGE.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60. [Content Brief]

[2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 0.6359 ng/mL, corresponding to a specific activity is 1.523×106 Unit/mg.

  • 1/16

    IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Aug 21;23(1):950. [Abstract]

    Customer Validation
     The migratory and invasive capabilities of HOS and MG-63 cells were assessed using Transwell assays in response to normoxic or hypoxic M0, M1, and M2 macrophages. THP-1 cells underwent differentiation into M0 macrophages following 24 h exposure to 100 ng/mL phorbol 12-myristate 13-acetate (PMA, HY-18739). Following a 24 h recovery in a fresh complete medium, cells were treated with 100 ng/mL lipopolysaccharide and 20 ng/mL IFN-gamma Protein, Human (IFN-γ, HY-P7025A) for 48 h to drive M1 polarization.

  • 1/16

    IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h

  • 1/16

    IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     Representative immunofluorescence images were used to observe the polarization of Raw264.7 cells into M1 macrophages (F4/80+iNOS+) F4/80 (green), iNOS (red), nucleus (blue). Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.

  • 1/16

    IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     RT-qPCR was employed to assess the expression levels of pro-inflammatory cytokines secreted by M1 macrophages, IL-1β, IL-6, and TNF-α in Raw264.7 cells.Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.

  • 1/16

    IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     Representative western blot images of SIRT6 protein. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.

  • IFN-gamma Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • Experimental Validation Results for IFN-gamma Protein, Human (CHO)
  • IFN-gamma Protein, Human (CHO) Product Image

  • IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Aug 21;23(1):950. [Abstract]

    The migratory and invasive capabilities of HOS and MG-63 cells were assessed using Transwell assays in response to normoxic or hypoxic M0, M1, and M2 macrophages. THP-1 cells underwent differentiation into M0 macrophages following 24 h exposure to 100 ng/mL phorbol 12-myristate 13-acetate (PMA, HY-18739). Following a 24 h recovery in a fresh complete medium, cells were treated with 100 ng/mL lipopolysaccharide and 20 ng/mL IFN-gamma Protein, Human (IFN-γ, HY-P7025A) for 48 h to drive M1 polarization.

  • IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h

  • IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Representative immunofluorescence images were used to observe the polarization of Raw264.7 cells into M1 macrophages (F4/80+iNOS+) F4/80 (green), iNOS (red), nucleus (blue). Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.

  • IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    RT-qPCR was employed to assess the expression levels of pro-inflammatory cytokines secreted by M1 macrophages, IL-1β, IL-6, and TNF-α in Raw264.7 cells.Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.

  • IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Representative western blot images of SIRT6 protein. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.