TGF alpha/TGFA Protein, Human (CHO)
Based on 1 publication(s) in Google Scholar
TGF-alpha Protein, Human (CHO) is a potent angiogenic mediator and mitogenic polypeptide.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
TGF-alpha Protein, Human (CHO) is a potent angiogenic mediator and mitogenic polypeptide.
Background
Transforming growth factors (TGF's) are polypeptides that can confer phenotypic transformation to several normal cells. TGF-α binds to the receptor for epidermal growth factor (EGF) and has been isolated from a variety of tumor cells. TGF-α is synthesized in embryos during early fetal development, in several virally transformed cells, and in a large variety of human tumors[1]. TGF-α is a member of the epidermal growth factor family of mitogens and associated with progression of transformed properties in human colon cancer cells[2].
Verified Bioactivity
The ED50 is <0.4 ng/mL as measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Commun Signal
Intestinal epithelial PIEZO1 regulates macrophage-to-myofibroblast transition via epithelial-derived TGF-α signaling in Crohn's disease. [Abstract]2026 May 28. PMID: 42210253
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
P01135 (V40-A89)
-
Molecular Construction
-
N-term
-
TGF-α (V40-A89)
Accession # P01135 -
C-term
-
-
Protein Length
Full Length of TGFA Chain
-
Synonyms
TGFA; Transforming Growth Factor, Alpha; Transforming Growth Factor Alpha; TGF-Alpha; Protransforming Growth Factor Alpha; TFGA; Transforming Growth Factor, Alpha, Isoform CRA_d
-
AA Sequence
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
-
Predicted Molecular Mass
5.6 kDa
-
Molecular Weight
Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Schreiber AB, et al. Transforming growth factor-alpha: a more potent angiogenic mediator than epidermal growth factor. Science. 1986 Jun 6;232(4755):1250-3. [Content Brief]
[2]. DuBois RN, et al. Regulation of eicosanoid production and mitogenesis in rat intestinal epithelial cells by transforming growth factor-alpha and phorbol ester. J Clin Invest. 1994 Feb;93(2):493-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
