IL-10 Protein, Mouse (CHO)

Customer Review

Based on 1 Customer Validation

IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-10 Protein, Mouse (CHO) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.

Background

The anti-inflammatory cytokine interleukin-10 (IL-10) is a pleiotropic cytokine that is produced in abundant quantities during most parasitic, bacterial, viral, and fungal diseases. IL-10 functions by dampening the innate or very early T cell immune response. Treatment with IL-10 may be useful adjunct therapy in some types of viral encephalitis. IL-10 primarily acts to suppress macrophages and dendritic cell (DC) function by inhibiting expression of major histocompatibility complex (MHC) class II and costimulatory molecules such as CD80/CD86 and production of proinflammatory cytokines and chemokines, including IL-12. IL-10 also has direct effects on T cells, inhibiting activation and cytokine expression. Production of IL-10 by highly activated virus-specific T cells raises the possibility that IL-10 functions via both autocrine and paracrine signaling to limit inflammation during acute phases of the disease[1].

Verified Bioactivity

1.The ED50 is <0.2 ng/mL as measured by MC/9 cells.
2.Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.2642 ng/mL.Corresponding to a specific activity is 3.785×106 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.2642 ng/mL.Corresponding to a specific activity is 3.785×106 U/mg.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-10 (S19-S178)
      Accession # P18893
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

  • Predicted Molecular Mass

    18.8 kDa

  • Molecular Weight

    Approximately 21-23 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5-7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00