IL-7 Protein, Mouse (CHO, His)
Based on 1 Customer Validation
IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.
Background
Interleukin-7 (IL-7) is a nonredundant cytokine produced by nonlymphoid cells that is essential for T-cell development in humans and mice and B-cell development in mice. IL-7 contributes to the maintenance of the size and subset composition of the peripheral T-cell pool by providing growth and survival signals through the IL-7 receptor. The IL-7 receptor has a private α-chain and shares the common γ-chain (γc) with other common cytokine receptor users, such as IL-2, IL-4, IL-15, and IL-21. IL-7 together with these cytokines regulates the expansion and contraction of adaptive immune responses and potentially the memory response to a given antigen. IL-7 modulates memory CD8+ T cells in response to a virus infection and, given in conjunction with adoptive transfer of T cells after herpes simplex virus type 1 infection, improves virus clearance[1].
Verified Bioactivity
The ED50 is <0.4 ng/mL as measured by 2E8 cells.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag C-His
-
Accession
P10168/Q544C8/NP_032397.1 (E26-I154)
-
Molecular Construction
-
N-term
-
IL-7 (E26-I154)
Accession # P10168/Q544C8/NP_032397.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized after extensive dialysis against PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)