IL-7 Protein, Human (CHO, His)
Based on 1 Customer Validation
IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.
Background
The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.
Verified Bioactivity
1.The cell proliferation assay using 2E8 cells has an ED50 value of less than 2 ng/mL.
2.Recombinant Human CD127 / IL-7RA immobilized on CM5 Chip can bind Human IL-7 with an affinity constant of 87.3 nM as determined in a SPR assay (Biacore 8K).
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-7*His
-
Accession
P13232-1 (D26-H177)
-
Molecular Construction
-
N-term
-
IL-7 (D26-H177)
Accession # P13232-1 -
7*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
-
Molecular Weight
Approximately 24-34 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
