IL-7 Protein, Human (CHO, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag. The total length of IL-7 Protein, Human (CHO, His) is 152 a.a., with molecular weight of 24-30 kDa.

The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.

The cell proliferation assay using 2E8 cells has an ED50 value of less than 2 ng/ml.

Human

CHO

C-His

P13232 (D26-H177)

3574  [NCBI]

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

24-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<0.2 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.