1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Rat

IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis.Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects.IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E.coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis.Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects.IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E.coli , with tag free.

Background

IL-7 Protein is a crucial hematopoietic cytokine that regulates the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby controlling the population of mature lymphocytes and ensuring lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors plays a significant role in mediating these effects.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IL-7 at 2 μg/mL (100 μL/well) on the plate can bind Rat CD127 Protein(HY-P77011). The ED50 for this effect is 2.158 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human IL-7 at 2 μg/mL (100 μL/well) on the plate can bind Rat CD127 Protein(HY-P77011). The ED50 for this effect is 2.158 μg/mL.
Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q91Y32 (D26-I154)

Gene ID
Molecular Construction
N-term
IL-7 (D26-I154)
Accession # Q91Y32
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin 7; Lymphopoietin-1; PBGF
AA Sequence

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

Predicted Molecular Mass
14.9 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-7 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-7 Protein, Rat

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Rat
Cat. No.:
HY-P73227
Quantity:
MCE Japan Authorized Agent: