IL-7 Protein, Rat
Based on 1 Customer Validation
IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis.Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects.IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E.coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis.Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects.IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E.coli , with tag free.
Background
IL-7 Protein is a crucial hematopoietic cytokine that regulates the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby controlling the population of mature lymphocytes and ensuring lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors plays a significant role in mediating these effects.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human IL-7 at 2 μg/mL (100 μL/well) on the plate can bind Rat CD127 Protein(HY-P77011). The ED50 for this effect is 2.158 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q91Y32 (D26-I154)
-
Molecular Construction
-
N-term
-
IL-7 (D26-I154)
Accession # Q91Y32 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)