Elastase, Porcine pancreas
Based on 6 publication(s) in Google Scholar
Elastase, Porcine pancreas (EC 3.4.21.36) is a single polypeptide chain of 240 amino acid residues, derived from pig pancreas. Elastase, Porcine pancreas is a serine protease that can hydrolyze proteins and polypeptide. Elastase from porcine pancreas can induce emphysema in hamsters.
For research use only. We do not sell to patients.
- CAS No.: 39445-21-1
- Formula: C1135H1759N331O346S10
- Molecular Weight:25898.13
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Elastase, Porcine pancreas
More
Biological Activity
Description
In Vitro
In-Solution Digestion Protocol
1. Resuspend Elastase in double-distilled water to a final concentration of 1 mg/mL. Store reconstituted Elastase at 4°C for up to 2 weeks.
2. Resuspend the protein in reaction buffer.
3. Add Elastase to protein solution; mix. We recommended using enzyme:protein ratios of 1:20 to 1:100.
4. Incubate 2-18 hours at 37°C.
5. Stop the reaction by adding 10% formic acid or TFA to a final concentration of 0.5% or by heating at 95°C for 10 minutes.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
EC Number
3.2.1.35
Specific Activity
≥40 U/mg protein
Unit Definition
One unit is defined as the amount of enzyme required to hydrolyze 1 mg Congo red-elastin within 30 min at 37°C, pH 7.0.
Chemical Information
-
CAS No. 39445-21-1
-
Appearance Solid
-
Molecular Weight 25898.13
-
Formula C1135H1759N331O346S10
-
Color White to off-white
-
SMILES
[Elastase, Porcine pancreas]
-
Synonyms
EC 3.4.21.36; Pancreatopeptidase E
-
Sequence Shortening
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGNGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN (Disulfide bridge: Cys30-Cys46; Cys127-Cys194; Cys158- Cys174; Cys184- Cys214)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (6)
-
Journal Impact Factor
-
Most Recent
-
ACS Nano
A Dual Glutathione-Depleting Nanoparticle Loaded with Porcine Pancreatic Elastase for Neoadjuvant Chemotherapy of Triple Negative Breast Cancer. [Abstract]2026 Feb 10;20(5):4166-4180. PMID: 41586575 -
-
Phytother Res
Geniposide modulates GSK3β to inhibit Th17 differentiation and mitigate endothelial damage in intracranial aneurysm. [Abstract]2024 Nov;38(11):5184-5202. PMID: 39180344 -
Biochem Pharmacol
Targeted endothelial GTPCH1/BH4 pathway activation reverses vascular dysfunction in smoking-associated obesity. [Abstract]2026 Jul:249:117931. PMID: 41895618 -
Biochem Biophys Res Commun
IL-27 blockade suppresses IL-10 modification in Th1 cells and promotes intracranial aneurysms rupture. [Abstract]2026 Aug 13:826:154004. PMID: 42184471 -
Solvent & Solubility
In Vitro:
H2O : 50 mg/mL (1.93 mM; ultrasonic and adjust pH to 9 with NaOH)
H2O : ≥ 5 mg/mL (0.19 mM)
* "≥" means soluble, but saturation unknown.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (274 KB)
-
SDS (557 KB)
- English - EN (557 KB)
- Français - FR (557 KB)
- Deutsch - DE (557 KB)
- Norwegian - NO (557 KB)
- Español - ES (557 KB)
- Swedish - SV (557 KB)
- Italian - IT (557 KB)
- Korean - KR (557 KB)
- Portuguese - PT (557 KB)
-
Handling Instructions (2659 KB)
References
[1]. Shotton DM, et, al. Amino-acid sequence of porcine pancreatic elastase and its homologies with other serine proteinases. Nature. 1970 Feb 28;225(5235):802-6. [Content Brief]
[2]. Teshima T, et, al. A new class of heterocyclic serine protease inhibitors. Inhibition of human leukocyte elastase, porcine pancreatic elastase, cathepsin G, and bovine chymotrypsin A alpha with substituted benzoxazinones, quinazolines, and anthranilates. J Biol Chem. 1982 May 10;257(9):5085-91. [Content Brief]
[3]. Stone PJ, et, al. Induction and exacerbation of emphysema in hamsters with human neutrophil elastase inactivated reversibly by a peptide boronic acid. Am Rev Respir Dis. 1990 Jan;141(1):47-52. [Content Brief]
Complete Stock Solution Preparation Table
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.0386 mL | 0.1931 mL | 0.3861 mL | 0.9653 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.