Iberiotoxin
Based on 2 publication(s) in Google Scholar
Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca2+-activated K+ channel inhibitor with a Kd of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels.
For research use only. We do not sell to patients.
- Purity: 99.71%
- CAS No.: 129203-60-7
- Formula: C179H274N50O55S7
- Molecular Weight:4230.85
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Iberiotoxin
More
Biological Activity
Iberiotoxin reversibly blocks Ca2+-activated K+ channel in excised membrane patches from bovine aortic smooth muscle. Iberiotoxin acts exclusively at the outer face of the channel and functions with IC50 values of about 250 pM. Iberiotoxin is a partial inhibitor of 125I-charybdotoxin binding in bovine aortic sarcolemmal membrane vesicles (Ki of 250 pM). Iberiotoxin functions as a noncompetitive inhibitor of charybdotoxin binding[1].
Iberiotoxin treatment affects rat mesenchymal stem cells (rMSCs) migration in the absence of platelet lysate (PL) by inducing a decrease in cell migration suggesting that BK channels regulate rMSCs migration in basal conditions. 10 nM of Iberiotoxin abolishes the PL-induced migration effect on MSCs[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 129203-60-7
-
Appearance Solid
-
Molecular Weight 4230.85
-
Formula C179H274N50O55S7
-
Color White to off-white
-
Sequence
{Glp}-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
-
Sequence Shortening
{Glp}-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
-
Structure Classification
-
Initial Source
Buthus tamulus
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
Salidroside ameliorates hypoxic pulmonary hypertension by regulating the two-pore domain potassium TASK-1 channel. [Abstract]2024 Oct 30:135:156206. PMID: 39520952 -
Mol Pain
EXPRESS: Piezo1-mediated neuroexcitation via collaboration with KCa1.1 and Nav1.9 currents in myelinated Ah-type of trigeminal ganglion neurons in rats: mechanistic insights with sex-specific effects. [Abstract]2025 Dec 12:17448069251410754. PMID: 41384612
Solvent & Solubility
DMSO : 50 mg/mL (11.82 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 0.7 mg/mL (0.17 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (299 KB)
-
SDS (480 KB)
- English - EN (480 KB)
- Français - FR (480 KB)
- Deutsch - DE (480 KB)
- Norwegian - NO (480 KB)
- Español - ES (480 KB)
- Swedish - SV (480 KB)
- Italian - IT (480 KB)
- Korean - KR (480 KB)
- Portuguese - PT (480 KB)
-
Handling Instructions (2659 KB)
References
[1]. A Galvez, et al. Purification and Characterization of a Unique, Potent, Peptidyl Probe for the High Conductance Calcium-Activated Potassium Channel From Venom of the Scorpion Buthus Tamulus. J Biol Chem. 1990 Jul 5;265(19):11083-90. [Content Brief]
[2]. Santiago Echeverry, et al. Activation of BK Channel Contributes to PL-Induced Mesenchymal Stem Cell Migration. Front Physiol. 2020 Mar 24;11:210. [Content Brief]
[3]. S Candia, et al. Mode of Action of Iberiotoxin, a Potent Blocker of the Large Conductance Ca(2+)-activated K+ Channel. Biophys J. 1992 Aug;63(2):583-90. [Content Brief]
[4]. R J Wang, et al. Downregulation of Large Conductance Calcium-Activated Potassium Channels in Paraventricular Nucleus Contributes to Sympathoexcitation in Rats With Chronic Heart Failure. Zhonghua Xin Xue Guan Bing Za Zhi. 2018 Mar 24;46(3):178-186. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2364 mL | 1.1818 mL | 2.3636 mL | 5.9090 mL |
| 5 mM | 0.0473 mL | 0.2364 mL | 0.4727 mL | 1.1818 mL | |
| 10 mM | 0.0236 mL | 0.1182 mL | 0.2364 mL | 0.5909 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.