GluN1(356-385)
Based on 1 Customer Validation
GluN1 (356-385) is a polypeptide targeting NMDAR GluN1. GluN1 (356-385) induces the production of autoantibodies, which reduce the density of cell surface NMDAR clusters, impair long-term potentiation, and decrease NMDAR-mediated Ca2+ influx. As an immunogen, GluN1 (356-385) induces symptoms similar to anti-NMDAR encephalitis, including memory loss, in mice. GluN1 (356-385) can be used to establish a mouse model that mimics the pathogenesis of anti-NMDAR encephalitis. GluN1 (356-385) is applicable to research related to anti-NMDAR encephalitis.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity : 99.95%
- 화학식: C154H248N46O42
- 분자량:3415.90
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- 순도&문서
- References
-
Help & FAQs
Biological Activity
제품 설명
In Vitro
GluN1(356-385)-induced antibody (24 h) reduce the density of surface GluN1-positive synaptic clusters and decrease membrane GluN1 levels in primary hippocampal neurons from embryonic day 18 rats[1].
GluN1(356-385)-induced antibody (18 h at 37 °C) significantly reduces NMDAR-mediated calcium influx in primary rat hippocampal neurons on embryonic day 18[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:C57BL/6 (female, 10 weeks old, induced by active immunization with GluN1(356-385) peptide)[1]
-
Dosage:200 μg
-
Administration:s.c.; initial immunization on back, followed by two booster injections at 4 and 8 weeks after initial immunization
-
Result:Showed significant memory loss, with decreased exploration time of a novel object and a lower discrimination index in the novel object recognition test .
Reduced visits to strangers in the three-chamber test.
Reduced hippocampal membrane GluN1 levels.
Impaired long-term potentiation (LTP) at Schaffer collateral-CA1 synapses, with a normalized field excitatory postsynaptic potential slope of 112% compared to 143% in controls.
Induced autoantibodies targeting GluN1 in cerebrospinal fluid and serum, maintained at high titers through the 12-week period, and localized primarily to the hippocampus and cerebellum.
Chemical Information
-
Appearance Solid
-
분자량 3415.90
-
화학식 C154H248N46O42
-
Color White to off-white
-
Sequence
Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu
-
Sequence Shortening
LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
용액&용해도
In Vitro:
DMSO : 66.67 mg/mL (19.52 mM; ultrasonic and adjust pH to 3 with 1 M HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
0.1 M Acetic acid : 25 mg/mL (7.32 mM; Need ultrasonic)
H2O : < 0.1 mg/mL (insoluble)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
순도&문서
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| 0.1 M Acetic acid / DMSO | 1 mM | 0.2927 mL | 1.4637 mL | 2.9275 mL | 7.3187 mL |
| 5 mM | 0.0585 mL | 0.2927 mL | 0.5855 mL | 1.4637 mL | |
| DMSO | 10 mM | 0.0293 mL | 0.1464 mL | 0.2927 mL | 0.7319 mL |
| 15 mM | 0.0195 mL | 0.0976 mL | 0.1952 mL | 0.4879 mL |
GluN1(356-385) Related Classifications
HY-P5912 Related Classifications
Powered by Bioz