Neuropeptide W-30 (rat)
Neuropeptide W-30 (rat) is an important stress mediator in the central nervous system that modulates the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. Neuropeptide W-30 (rat) is an endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8. NPW-30 activates and binds to both GPR7 and GPR8 at similar effective doses.
For research use only. We do not sell to patients.
- CAS No.: 383415-90-5
- Formula: C165H249N49O38S
- Molecular Weight:3559.11
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Chemical Information
-
CAS No. 383415-90-5
-
Molecular Weight 3559.11
-
Formula C165H249N49O38S
-
Synonyms
NPW30, rat
-
Sequence
Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp
-
Sequence Shortening
WYKHVASPRYHTVGRASGLLMGLRRSPYLW
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Makoto Kawasaki, et al. Centrally administered neuropeptide W-30 activates magnocellular neurosecretory cells in the supraoptic and paraventricular nuclei with neurosecretion in rats. J Endocrinol. 2006 Aug;190(2):213-23. [Content Brief]
[2]. Nan-Shou Yu, et al. Effects of intracerebroventricular administration of neuropeptide W30 on neurons in the hypothalamic paraventricular nucleus in the conscious rat. Neurosci Lett. 2007 Mar 26;415(2):140-5. [Content Brief]
[3]. Yukio Shimomura, et al. Identification of neuropeptide W as the endogenous ligand for orphan G-protein-coupled receptors GPR7 and GPR8. J Biol Chem. 2002 Sep 27;277(39):35826-32. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)