Amelotin Protein, Human (HEK293, Fc)

Amelotin Protein is a key promoter of calcium phosphate mineralization, crucial in amelogenesis maturation. It plays a vital role in forming the compact and mineralized aprismatic enamel surface layer, emphasizing its crucial involvement in orchestrating molecular events for robust enamel structure during tooth maturation. Amelotin Protein, Human (HEK293, Fc) is the recombinant human-derived Amelotin, expressed by HEK293, with C-mFc labeled tag. The total length of Amelotin Protein, Human (HEK293, Fc) is 193 a.a..

Amelotin emerges as a key promoter of calcium phosphate mineralization, playing a pivotal role in the intricate process of amelogenesis during the maturation stage. Specifically, Amelotin's contribution is vital in the formation of the compact and mineralized aprismatic enamel surface layer. This underscores its crucial involvement in orchestrating the intricate molecular events that lead to the development of a robust and mineralized enamel structure during tooth maturation.

Human

HEK293

C-mFc

Q6UX39-1 (L17-Q209)

401138  [NCBI]

Full Length of Isoform-1 Mature Protein

LPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ

Approximately 55-75 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.