AQP1 Protein, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

AQP1, a water-specific channel, plays a pivotal role in enhancing the permeability of plasma membranes in red blood cells and kidney proximal tubules, allowing water movement along osmotic gradients. It forms homotetramers and is a key component of the ankyrin-1 complex, a multiprotein assembly crucial for maintaining the stability and shape of erythrocyte membranes. In the erythrocyte, the ankyrin-1 complex consists of AQP1 along with ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPA, and GYPB. AQP1's functional versatility is further highlighted by its interaction with EPHB2, contributing to endolymph production in the inner ear. Additionally, AQP1 participates in complexes involving STOM. The protein establishes interactions both via its N-terminal region with ANK1 and via its C-terminal region with EPB42, emphasizing its engagement in various cellular processes and protein assemblies.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • AQP1 (G220-K269)
      Accession # P29972
    • C-term
  • Protein Length

    Partial

  • Synonyms

    AQP1; Aquaporin 1 (Channel-Forming Integral Protein, 28kDa); Prev. CO; Aquaporin 1, Colton Blood Group Antigen; CHIP28; Aquaporin 1 Splice Variant 2; Aquaporin-CHIP; Colton Blood Group Antigen; Aquaporin-1; Bloodgroup CO Protein; Aquaporin 1 (Channel-Form

  • AA Sequence

    GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

  • Predicted Molecular Mass

    21.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00