BRPF3 Protein, Human
Based on 1 publication(s) in Google Scholar
The BRPF3 protein is a scaffold in various HAT complexes such as MOZ/MORF and HBO1 and is critical for histone H3 acetylation, especially in directing the specificity of KAT7/HBO1 for H3K14ac. In the HBO1 complex, BRPF3 promotes DNA replication initiation and activates replication origins. BRPF3 Protein, Human is the recombinant human-derived BRPF3 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The BRPF3 protein is a scaffold in various HAT complexes such as MOZ/MORF and HBO1 and is critical for histone H3 acetylation, especially in directing the specificity of KAT7/HBO1 for H3K14ac. In the HBO1 complex, BRPF3 promotes DNA replication initiation and activates replication origins. BRPF3 Protein, Human is the recombinant human-derived BRPF3 protein, expressed by E. coli , with tag free.
BRPF3, serving as a scaffold subunit in diverse histone acetyltransferase (HAT) complexes, including MOZ/MORF and HBO1, is instrumental in histone H3 acetylation activities. Particularly, in the HBO1 complex, BRPF3 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac), thereby facilitating the initiation of DNA replication and promoting the activation of replication origins. As part of the MOZ/MORF complex, BRPF3 collaborates with key components such as ING5, KAT6A, KAT6B, and MEAF6. Moreover, BRPF3 is a vital member of specific HBO1 complexes composed of KAT7/HBO1, MEAF6, and ING4 or ING5. The direct interaction between BRPF3 and KAT7/HBO1 highlights its role as a critical mediator in these HAT complexes, shedding light on its involvement in the intricate regulation of histone acetylation and DNA replication processes.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Acta Pharm Sin B
2025 Oct;15(10):5192-5211. PMID: 41132846
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9ULD4 (D1056-G1195)
-
Gene ID27154
-
Molecular Construction
-
N-term
-
BRPF3 (D1056-G1195)
Accession # Q9ULD4 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BRPF3; Bromodomain and PHD finger-containing protein 3
-
AA Sequence
DYNGSGRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
