1. Recombinant Proteins
  2. Others
  3. BRPF3 Protein, Human

The BRPF3 protein is a scaffold in various HAT complexes such as MOZ/MORF and HBO1 and is critical for histone H3 acetylation, especially in directing the specificity of KAT7/HBO1 for H3K14ac. In the HBO1 complex, BRPF3 promotes DNA replication initiation and activates replication origins. BRPF3 Protein, Human is the recombinant human-derived BRPF3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE BRPF3 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BRPF3 protein is a scaffold in various HAT complexes such as MOZ/MORF and HBO1 and is critical for histone H3 acetylation, especially in directing the specificity of KAT7/HBO1 for H3K14ac. In the HBO1 complex, BRPF3 promotes DNA replication initiation and activates replication origins. BRPF3 Protein, Human is the recombinant human-derived BRPF3 protein, expressed by E. coli , with tag free.

Background

BRPF3, serving as a scaffold subunit in diverse histone acetyltransferase (HAT) complexes, including MOZ/MORF and HBO1, is instrumental in histone H3 acetylation activities. Particularly, in the HBO1 complex, BRPF3 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac), thereby facilitating the initiation of DNA replication and promoting the activation of replication origins. As part of the MOZ/MORF complex, BRPF3 collaborates with key components such as ING5, KAT6A, KAT6B, and MEAF6. Moreover, BRPF3 is a vital member of specific HBO1 complexes composed of KAT7/HBO1, MEAF6, and ING4 or ING5. The direct interaction between BRPF3 and KAT7/HBO1 highlights its role as a critical mediator in these HAT complexes, shedding light on its involvement in the intricate regulation of histone acetylation and DNA replication processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9ULD4 (D1056-G1195)

Gene ID

27154

Molecular Construction
N-term
BRPF3 (D1056-G1195)
Accession # Q9ULD4
C-term
Protein Length

Partial

Synonyms
BRPF3; Bromodomain and PHD finger-containing protein 3
AA Sequence

DYNGSGRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRG

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BRPF3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BRPF3 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BRPF3 Protein, Human
Cat. No.:
HY-P702058
Quantity:
MCE Japan Authorized Agent: