1. Recombinant Proteins
  2. Others
  3. BTLA/CD272 Protein, Cynomolgus (HEK293, His)

BTLA/CD272 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P703766
Handling Instructions Technical Support

BTLA/CD272 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BTLA protein, expressed by HEK293, with C-His tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

BTLA/CD272 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BTLA protein, expressed by HEK293, with C-His tag.

Background

BTLA is an inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It can interact with TNFRSF14 either in cis (on the same cell) or in trans (on other cells). In cis interactions, BTLA appears to play an immune regulatory role by inhibiting trans interactions in naive T cells to maintain a resting state. In trans interactions, it may predominate during adaptive immune responses to provide survival signals to effector T cells.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5W7M7 (K31-P152)

Protein Length

Partial

AA Sequence

KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP

Predicted Molecular Mass
15 kDa
분자량

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

BTLA/CD272 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

BTLA/CD272 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
BTLA/CD272 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P703766
수량:
MCE Japan Authorized Agent: