BTLA/CD272 Protein, Cynomolgus (HEK293, His)
BTLA/CD272 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BTLA protein, expressed by HEK293, with C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTLA/CD272 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BTLA protein, expressed by HEK293, with C-His tag.
Background
BTLA is an inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It can interact with TNFRSF14 either in cis (on the same cell) or in trans (on other cells). In cis interactions, BTLA appears to play an immune regulatory role by inhibiting trans interactions in naive T cells to maintain a resting state. In trans interactions, it may predominate during adaptive immune responses to provide survival signals to effector T cells.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5W7M7 (K31-P152)
-
Gene ID151888
-
Protein Length
Partial
-
Synonyms
BTLA; BTLA1; B And T Lymphocyte Associated; CD272; B- And T-Lymphocyte-Associated Protein; Alternative Protein BTLA; B- And T-Lymphocyte Attenuator; CD272 Antigen
-
AA Sequence
KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
