C4B/Complement C4-B Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P0C0L5 (E1454-V1744)
-
Gene ID100293534
-
Molecular Construction
-
N-term
-
C4B (E1454-V1744)
Accession # P0C0L5 -
6*His
-
C-term
-
-
Protein Length
Full Length of Complement C4 gamma Chain
-
Synonyms
C4B; Basic Complement C4; Complement C4B (Chido/Rodgers Blood Group); Complement C4B1a; CPAMD3; Complement C4-B; C4B1; C4B5; C4B3; Complement Component 4B (Chido/Rodgers Blood Group), Copy 2; CO4; Complement Protein C4B Frameshift Mutant; C4F; Chido Form
-
AA Sequence
EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
-
Predicted Molecular Mass
40.0 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
