1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins Biotinylated Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)

Cat. No.: HY-P76200
Handling Instructions Technical Support

CD137, also known as 4-1BB, is a protein that exhibits defects in conserved residues required for feature annotation propagation. Specific residues missing in CD137 prevent the propagation of certain functional features associated with this protein. CD137/4-1BB Protein, Rhesus Macaque (Biotinylated, HEK293, His) is the recombinant Rhesus Macaque-derived CD137/4-1BB protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD137, also known as 4-1BB, is a protein that exhibits defects in conserved residues required for feature annotation propagation. Specific residues missing in CD137 prevent the propagation of certain functional features associated with this protein. CD137/4-1BB Protein, Rhesus Macaque (Biotinylated, HEK293, His) is the recombinant Rhesus Macaque-derived CD137/4-1BB protein, expressed by HEK293 , with C-His labeled tag.

Background

CD137, also known as 4-1BB, is a protein that exhibits a deficiency in conserved residue(s) required for the propagation of feature annotation. The specific residue(s) that are missing in CD137 hinder the propagation of certain functional characteristics associated with this protein. CD137 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a significant role in immune regulation and activation of immune cells.

In Vitro

4-1BB (Cynomolgus monkey) binds to STA551, and Uto-hIgG2 with Kd value of 25.1 nM and 13 nM, respectively[4].

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-His

Accession

A9YYE7/F6W5G6 (L24-Q186)

Gene ID

102127961/708281  [NCBI]

Molecular Construction
N-term
4-1BB (L24-Q186)
Accession # A9YYE7/F6W5G6
His
C-term
Protein Length

Partial

Conjugation

Biotin

Conjugate Method

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137
AA Sequence

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Predicted Molecular Mass
18.7 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)
Cat. No.:
HY-P76200
Quantity:
MCE Japan Authorized Agent: