CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)
CD137, also known as 4-1BB, is a protein that exhibits defects in conserved residues required for feature annotation propagation. Specific residues missing in CD137 prevent the propagation of certain functional features associated with this protein. CD137/4-1BB Protein, Rhesus Macaque (Biotinylated, HEK293, His) is the recombinant Rhesus Macaque-derived CD137/4-1BB protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rhesus Macaque; Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD137, also known as 4-1BB, is a protein that exhibits defects in conserved residues required for feature annotation propagation. Specific residues missing in CD137 prevent the propagation of certain functional features associated with this protein. CD137/4-1BB Protein, Rhesus Macaque (Biotinylated, HEK293, His) is the recombinant Rhesus Macaque-derived CD137/4-1BB protein, expressed by HEK293 , with C-His labeled tag.
Background
CD137, also known as 4-1BB, is a protein that exhibits a deficiency in conserved residue(s) required for the propagation of feature annotation. The specific residue(s) that are missing in CD137 hinder the propagation of certain functional characteristics associated with this protein. CD137 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a significant role in immune regulation and activation of immune cells.
Technical Parameters
-
Species Rhesus Macaque; Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
A9YYE7/F6W5G6 (L24-Q186)
-
Molecular Construction
-
N-term
-
4-1BB (L24-Q186)
Accession # A9YYE7/F6W5G6 -
His
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Conjugate Method
The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.
-
Synonyms
TNFRSF9; CDw137; Prev. ILA; Tumor Necrosis Factor Receptor Superfamily, Member 9; CD137; Induced By Lymphocyte Activation (ILA); 4-1BB; Homolog Of Mouse 4-1BB; Tumor Necrosis Factor Receptor Superfamily Member 9; Receptor Protein 4-1BB; T-Cell Antigen 4-1
-
AA Sequence
LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ
-
Predicted Molecular Mass
18.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
