CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His)

CD137, also known as 4-1BB, is a protein that exhibits defects in conserved residues required for feature annotation propagation. Specific residues missing in CD137 prevent the propagation of certain functional features associated with this protein. CD137/4-1BB Protein, Rhesus Macaque (Biotinylated, HEK293, His) is the recombinant Rhesus Macaque-derived CD137/4-1BB protein, expressed by HEK293 , with C-His labeled tag.

CD137, also known as 4-1BB, is a protein that exhibits a deficiency in conserved residue(s) required for the propagation of feature annotation. The specific residue(s) that are missing in CD137 hinder the propagation of certain functional characteristics associated with this protein. CD137 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a significant role in immune regulation and activation of immune cells.

4-1BB (Cynomolgus monkey) binds to STA551, and Uto-hIgG2 with K_d value of 25.1 nM and 13 nM, respectively^[4].

Rhesus Macaque; Cynomolgus

HEK293

C-His

A9YYE7/F6W5G6 (L24-Q186)

102127961/708281  [NCBI]

Partial

Biotin

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.