Copy Link Print Information

CD300a/LMIR1 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD300a/LMIR1 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD300a/LMIR1, an inhibitory receptor, potentially plays a role in diminishing cytolytic activity in natural killer (NK) cells and suppressing mast cell degranulation. Additionally, it acts as a negative regulator in Toll-like receptor (TLR) signaling mediated by MYD88, although not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1 and PTPN11/SHP-2, as well as INPP5D, illustrating its multifaceted involvement in immune regulation and cellular responses.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession

    A0A7N9CE79 (L18-Q178)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • CD300a (L18-Q178)
      Accession # A0A7N9CE79
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD300A; CMRF35-Like Molecule 8; CD300a Molecule; NK Inhibitory Receptor; CMRF-35-H9; CMRF35-H9; CMRF35H; IRC1/IRC2; IGSF12; CMRF35-H; CD300a Antigen; CLM-8; Irp60; CMRF35H Leukocyte Immunoglobulin-Like Receptor; IRC1; Leukocyte Membrane Antigen; IRC2; CMR

  • AA Sequence

    LRGPSTVDGPVGGSLSVQCRYEEKHKTFNKYWCRPPRVLRCAKIVETKGPAGKMNGRVSIMDCPQNLSFTVTLENLTEEDAGTYWCGVDTPWLQDLHDPYVQVEVSVFPASTSMTPTSITAAKTSTITTVFPPVSSTSLFAVSATHSTSNWKENEEVVSSQ

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD300a/LMIR1 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • CD300a/LMIR1 Protein, Cynomolgus (HEK293, His) Product Image