CD40 Protein, Rat (HEK293, Fc)
CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD40, also referred to as TNFR5, is a protein that exhibits deficiency in conserved residue(s) essential for feature annotation propagation. The specific residue(s) missing in CD40 prevent the propagation of certain functional characteristics associated with this protein. CD40 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in immune regulation and activation of various immune cells.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
A6JXD6 (L20-R193)
-
Molecular Construction
-
N-term
-
CD40 (L20-R193)
Accession # A6JXD6 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
LGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQPCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCAQHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTSQTDTLCGFQPRMR
-
Predicted Molecular Mass
46.2 kDa
-
Molecular Weight
Approximately 53 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
