CD99 Protein, Human (HEK293, His)
The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, His) is the recombinant human-derived CD99 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, His) is the recombinant human-derived CD99 protein, expressed by HEK293 , with N-His labeled tag.
Background
CD99 protein participates in crucial T-cell adhesion processes, contributing to spontaneous rosette formation with erythrocytes. Additionally, it plays a vital role in the late stages of leukocyte extravasation, aiding leukocytes in overcoming the endothelial basement membrane during immune responses. Remarkably, its function is independent of PECAM1, although it acts at the same site. The involvement of CD99 in T-cell adhesion processes underscores its significance in mediating cellular interactions essential for immune function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-8*His
-
Accession
P14209-1 (D23-D122)
-
Molecular Construction
-
N-term
-
8*His
-
CD99 (D23-D122)
Accession # P14209-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD99; MIC2 (Monoclonal Antibody 12E7); Prev. MIC2X; Cell Surface Antigen 12E7; Prev. MIC2Y; Cell Surface Antigen O13; Prev. MIC2; Surface Antigen MIC2; CD99 Antigen; CD99 Molecule; Antigen Identified By Monoclonal Antibodies 12E7, F21 And O13; Protein MIC
-
AA Sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
-
Predicted Molecular Mass
11.2 kDa
-
Molecular Weight
Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)