CDK5 Protein, Human (sf9, GST)
CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5, Human (sf9, GST) is the recombinant human-derived CDK5 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CDK5 is a proline-directed serine/threonine protein kinase that critically regulates neuronal cell cycle, differentiation and potential apoptosis in neuronal diseases by preventing cell cycle re-entry. It interacts with numerous proteins involved in neuronal development and coordinates processes such as survival, migration, differentiation, axonal growth, synaptogenesis, and neurotransmission. CDK5, Human (sf9, GST) is the recombinant human-derived CDK5 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
CDK5, a proline-directed serine/threonine-protein kinase, stands as an essential player in neuronal cell cycle regulation, differentiation, and the potential induction of apoptotic cell death in neuronal diseases by instigating abortive cell cycle re-entry. Its interactions span a spectrum, engaging with proteins like D1 and D3-type G1 cyclins, SRC, NOS3, VIM/vimentin, p35/CDK5R1, MEF2A, SIPA1L1, SH3GLB1, PXN, PAK1, MCAM/MUC18, SEPT5, SYN1, DNM1, AMPH, SYNJ1, CDK16, RAC1, RHOA, CDC42, TONEBP/NFAT5, MAPT/TAU, MAP1B, histone H1, p53/TP53, HDAC1, APEX1, PTK2/FAK1, huntingtin/HTT, ATM, MAP2, NEFH, and NEFM. Functionally, CDK5 orchestrates critical processes in neuronal development, including survival, migration, differentiation, axonal and neurite growth, synaptogenesis, oligodendrocyte differentiation, synaptic plasticity, and neurotransmission, achieved by phosphorylating key proteins. Additionally, it negatively regulates the CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. In the mature central nervous system, CDK5 plays a pivotal role in neurotransmitter movements and cell survival, activating anti-apoptotic proteins BCL2 and STAT3 while negatively regulating JNK3/MAPK10 activity. Its multifaceted functions encompass the intricate regulation of various cellular processes, including DNA damage response, Wnt/beta-catenin signaling, and the GAIT pathway. Moreover, CDK5 impacts dendritic spine morphogenesis and participates in circadian clock regulation by modulating CLOCK protein function.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-GST
-
Accession
Q00535-1 (M1-P292)
-
Gene ID1020
-
Molecular Construction
-
N-term
-
GST
-
(M1-P292)
Accession # Q00535-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CDK5; Cyclin-Dependent Kinase 5; Cyclin Dependent Kinase 5; TPKII Catalytic Subunit; PSSALRE; Epididymis Secretory Sperm Binding Protein; Serine/Threonine-Protein Kinase PSSALRE; Protein Kinase CDK5 Splicing; Tau Protein Kinase II Catalytic Subunit; CDKN5
-
AA Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)