Copy Link Print Information

DPYSL2 Protein, Human (P.pastoris, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • DPYSL2 Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

Background

DPYSL2 protein is actively involved in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. Its crucial role extends to signaling by class 3 semaphorins and subsequent cytoskeletal remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. The interaction with CYFIP1/SRA1 occurs through its C-terminus, and DPYSL2 also interacts with HTR4, CLN6, and MICALL1. These protein interactions highlight DPYSL2's multifaceted involvement in various cellular processes critical for neuronal function and development.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-His
  • Accession

    Q16555 (M1-G572)

  • Gene ID
    1808  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • DPYSL2 (1M-572G)
      Accession # Q16555
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    DPYSL2; ULIP-2; Dihydropyrimidinase Like 2; ULIP2; DRP-2; N2A3; CRMP2; Collapsin Response Mediator Protein HCRMP-2; Dihydropyrimidinase-Related Protein 2; Collapsin Response Mediator Protein 2; DHPRP2; Dihydropyrimidinase-Like 2 Short Form; DRP2; Dihydrop

  • AA Sequence

    MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

  • Predicted Molecular Mass

    64.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DPYSL2 Protein, Human (P.pastoris, His) Product Image
    1/16
  • DPYSL2 Protein, Human (P.pastoris, His) Product Image