FABP1/L-FABP Protein, Human (His, solution)
Based on 1 Customer Validation
FABP1/L-FABP Protein is crucial for lipoprotein-mediated cholesterol uptake in hepatocytes, specifically binding cholesterol, free fatty acids, coenzyme A derivatives, and bilirubin within the cytoplasm. It may also participate in intracellular lipid transport, sharing similarities with other proteins. FABP1/L-FABP Protein, Human (His, solution) is the recombinant human-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FABP1/L-FABP Protein is crucial for lipoprotein-mediated cholesterol uptake in hepatocytes, specifically binding cholesterol, free fatty acids, coenzyme A derivatives, and bilirubin within the cytoplasm. It may also participate in intracellular lipid transport, sharing similarities with other proteins. FABP1/L-FABP Protein, Human (His, solution) is the recombinant human-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.
Background
The FABP1/L-FABP protein plays a vital role in the uptake of cholesterol mediated by lipoproteins in hepatocytes. It has been shown to specifically bind cholesterol, as well as other molecules such as free fatty acids and their coenzyme A derivatives, along with bilirubin, within the cytoplasm. Additionally, there is a possibility that FABP1/L-FABP is involved in intracellular lipid transport, based on similarities with other proteins.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P07148 (M1-I127)
-
Molecular Construction
-
N-term
-
6*His
-
FABP1 (M1-I127)
Accession # P07148 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FABP1; Fatty Acid-Binding Protein, Liver; Fatty Acid Binding Protein 1; Fatty Acid Binding Protein 1, Liver; L-FABP; FABPL; Liver-Type Fatty Acid-Binding Protein; Fatty Acid-Binding Protein 1
-
AA Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.5 M Argine, 50% glycerol, 2 mM EDTA, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
