Frataxin/FXN Protein, Cynomolgus (His)
Based on 1 Customer Validation
Frataxin (FXN) protein activates persulfide transfer, which is critical for [2Fe-2S] cluster assembly. It accelerates sulfur transfer from NFS1 persulfide to ISCU and small thiols, resulting in oversulfide and sulfide release. Frataxin/FXN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived Frataxin/FXN protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Frataxin (FXN) protein activates persulfide transfer, which is critical for [2Fe-2S] cluster assembly. It accelerates sulfur transfer from NFS1 persulfide to ISCU and small thiols, resulting in oversulfide and sulfide release. Frataxin/FXN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived Frataxin/FXN protein, expressed by E. coli , with N-6*His labeled tag.
Background
Frataxin (FXN) Protein serves as an activator in the persulfide transfer process within the core iron-sulfur cluster (ISC) assembly complex, crucial for [2Fe-2S] cluster assembly. It facilitates the acceleration of sulfur transfer from NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. During [2Fe-2S] cluster assembly, FXN binds ferrous ions and is released upon the addition of both L-cysteine and reduced FDX2. The ISC assembly complex, consisting of FXN, NFS1, LYRM4, NDUFAB1, and FDX2, initiates de novo synthesis of [2Fe-2S] clusters, transferring them to chaperone proteins such as HSCB, HSPA9, and GLRX5. FXN may play a role in protecting against iron-catalyzed oxidative stress, displaying ferroxidase activity in its oligomeric form. It could potentially store large amounts of iron in the form of a ferrihydrite mineral through oligomerization, although the physiological relevance remains uncertain. FXN may function as an iron chaperone protein, safeguarding the aconitase [4Fe-4S]2+ cluster from disassembly and promoting enzyme reactivation. Additionally, it might serve as a high-affinity iron-binding partner for FECH, contributing to the terminal step in mitochondrial heme biosynthesis. FXN modulates the RNA-binding activity of ACO1, potentially participates in cytoplasmic iron-sulfur protein biogenesis, and could contribute to oxidative stress resistance and overall cell survival.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8HXX9 (S81-A210)
-
Molecular Construction
-
N-term
-
6*His
-
Frataxin (S81-A210)
Accession # Q8HXX9 -
C-term
-
-
Protein Length
Full Length of Extramitochondrial frataxin Chain
-
Synonyms
FXN; CyaY; Prev. FRDA; Friedreich Ataxia Protein; X25; Friedreich Ataxia; Frataxin, Mitochondrial; Fxn; FARR; Frataxin; FA
-
AA Sequence
SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
-
Predicted Molecular Mass
18.2 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)