Frataxin/FXN Protein, Cynomolgus (His)

Frataxin (FXN) protein activates persulfide transfer, which is critical for [2Fe-2S] cluster assembly. It accelerates sulfur transfer from NFS1 persulfide to ISCU and small thiols, resulting in oversulfide and sulfide release. Frataxin/FXN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived Frataxin/FXN protein, expressed by E. coli , with N-6*His labeled tag.

Frataxin (FXN) Protein serves as an activator in the persulfide transfer process within the core iron-sulfur cluster (ISC) assembly complex, crucial for [2Fe-2S] cluster assembly. It facilitates the acceleration of sulfur transfer from NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. During [2Fe-2S] cluster assembly, FXN binds ferrous ions and is released upon the addition of both L-cysteine and reduced FDX2. The ISC assembly complex, consisting of FXN, NFS1, LYRM4, NDUFAB1, and FDX2, initiates de novo synthesis of [2Fe-2S] clusters, transferring them to chaperone proteins such as HSCB, HSPA9, and GLRX5. FXN may play a role in protecting against iron-catalyzed oxidative stress, displaying ferroxidase activity in its oligomeric form. It could potentially store large amounts of iron in the form of a ferrihydrite mineral through oligomerization, although the physiological relevance remains uncertain. FXN may function as an iron chaperone protein, safeguarding the aconitase [4Fe-4S]2+ cluster from disassembly and promoting enzyme reactivation. Additionally, it might serve as a high-affinity iron-binding partner for FECH, contributing to the terminal step in mitochondrial heme biosynthesis. FXN modulates the RNA-binding activity of ACO1, potentially participates in cytoplasmic iron-sulfur protein biogenesis, and could contribute to oxidative stress resistance and overall cell survival.

Cynomolgus

E. coli

N-6*His

Q8HXX9 (S81-A210)

102120656  [NCBI]

Partial

SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Approximately 22 kDa.The reducing (R) protein migrat es as 22 kDa in SDS-PAGE may be due to relative charge.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.