PPP2CA Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P67775-1 (M1-L309)
-
Gene ID3976
-
Molecular Construction
-
N-term
-
6*His
-
PPP2CA (M1-L309)
Accession # P67775 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PPP2CA; RP-C; Protein Phosphatase 2 Catalytic Subunit Alpha; Protein Phosphatase 2 (Formerly 2A), Catalytic Subunit, Alpha Isoform; PP2Calpha; Protein Phosphatase 2A Catalytic Subunit, Alpha Isoform; PP2AC; Serine/Threonine-Protein Phosphatase; Serine/Thr
-
AA Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
-
Predicted Molecular Mass
42.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
