HHLA2 Protein, Cynomolgus (HEK293, His)
HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived HHLA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of HHLA2 Protein, Cynomolgus (HEK293, His) is 325 a.a., with molecular weight of 60-70 kDa.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived HHLA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of HHLA2 Protein, Cynomolgus (HEK293, His) is 325 a.a., with molecular weight of 60-70 kDa.
Background
The HHLA2 protein, a pivotal player in immune regulation, engages in a significant interaction with TMIGD2 to provide costimulation to T-cells during T-cell receptor (TCR)-mediated activation. This interaction, in turn, amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. The collaboration between HHLA2 and TMIGD2 underscores the intricate molecular mechanisms involved in enhancing T-cell responses, shedding light on its role in immune modulation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
XP_005548285.1 (I21-N345)
-
Molecular Construction
-
N-term
-
HHLA2 (I21-N345)
Accession # XP_005548285.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
HHLA2; B7y; HHLA2 Member Of B7 Family; Human Endogenous Retrovirus-H Long Terminal Repeat-Associating Protein 2; B7-H5; HERV-H LTR-Associating Protein 2; B7-H7; HERV-H LTR-Associating 2; B7H7
-
AA Sequence
IFLSAFFTYVPMNEQIIIGRLGEDIILPSSFERGSEVVIHWKYQDSYNSYNVHSYYKGSGRLESQDTRYANRTSLFYNEIQNGNASLFFRRLSLLDEGIYTCYVGTAIQAITNKVVLKVGVFLTPMMKYEKRNTNSFLICNVLSVYPRPIITWKMDNTPISENNMQETGSLGPFSINSTLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCELVNDYFSPNQDFKVTWSRMESGISSILAYYLSSSQNTTFYESRFSWNKELKNQSDFSMNLTDLSLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASDN
-
Predicted Molecular Mass
39.2 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
