HHLA2 Protein, Cynomolgus (HEK293, His)

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived HHLA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of HHLA2 Protein, Cynomolgus (HEK293, His) is 325 a.a., with molecular weight of 60-70 kDa.

The HHLA2 protein, a pivotal player in immune regulation, engages in a significant interaction with TMIGD2 to provide costimulation to T-cells during T-cell receptor (TCR)-mediated activation. This interaction, in turn, amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. The collaboration between HHLA2 and TMIGD2 underscores the intricate molecular mechanisms involved in enhancing T-cell responses, shedding light on its role in immune modulation.

Cynomolgus

HEK293

C-His

XP_005548285.1 (I21-N345)

102137704  [NCBI]

IFLSAFFTYVPMNEQIIIGRLGEDIILPSSFERGSEVVIHWKYQDSYNSYNVHSYYKGSGRLESQDTRYANRTSLFYNEIQNGNASLFFRRLSLLDEGIYTCYVGTAIQAITNKVVLKVGVFLTPMMKYEKRNTNSFLICNVLSVYPRPIITWKMDNTPISENNMQETGSLGPFSINSTLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCELVNDYFSPNQDFKVTWSRMESGISSILAYYLSSSQNTTFYESRFSWNKELKNQSDFSMNLTDLSLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASDN

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.