HIST3H2A Protein, Human
Based on 1 Customer Validation
The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.
Background
HIST3H2A, as a core component of the nucleosome, participates in the essential process of wrapping and compacting DNA into chromatin, thereby limiting DNA accessibility to cellular machineries that rely on DNA as a template. This histone protein, like others, holds a pivotal position in key cellular functions such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate control of DNA accessibility involves a sophisticated system of post-translational modifications known as the histone code, along with dynamic nucleosome remodeling. The nucleosome itself is a histone octamer comprising two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, underscoring its crucial role in organizing chromatin structure and facilitating essential genomic processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q7L7L0 (S2-K130)
-
Gene ID92815 [NCBI]
-
Molecular Construction
-
N-term
-
HIST3H2A (S2-K130)
Accession # Q7L7L0 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
H2AC25; Histone H2A Type 3; Prev. HIST3H2A; H2A.W Histone; Prev. H2AW; MGC3165; Histone Cluster 3, H2a; H2A-Clustered Histone 25; Histone Cluster 3 H2A; H2A Clustered Histone 25; Histone 3, H2a
-
AA Sequence
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)