HMOX1 Protein, Rat (P. pastoris, His)
- Species: Rat
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Rat
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P06762 (M1-M289)
-
Gene ID24451
-
Molecular Construction
-
N-term
-
6*His
-
Hmox1 (M1-M289)
Accession # P06762 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Heme oxygenase 1; EC:1.14.14.18; HO-1; HSP32; Heme oxygenase 1 soluble form 1 publication; Hmox1
-
AA Sequence
MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
-
Predicted Molecular Mass
35.0 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
