HSCB Protein, Human (His, Strep)
HSCB Protein, Human (His, Strep) is the recombinant human-derived HSCB, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HSCB Protein, Human (His, Strep) is the recombinant human-derived HSCB, expressed by E. coli , with Strep, His labeled tag. ,
HSCB acts as a co-chaperone in mitochondrial iron-sulfur cluster assembly, facilitating the incorporation of iron-sulfur clusters into SDHB, the iron-sulfur protein subunit of succinate dehydrogenase involved in mitochondrial complex II. It is recruited to SDHB via interaction with SDHAF1, which first binds SDHB and then recruits the iron-sulfur transfer complex (composed of HSC20, HSPA9, and ISCU) through direct binding to HSC20. HSCB also plays an essential role in hematopoiesis (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q8IWL3 (M1-L235)
-
Gene ID150274
-
Protein Length
Full Length
-
Synonyms
HSCB; HscB Mitochondrial Iron-Sulfur Cluster Co-Chaperone; HscB Mitochondrial Iron-Sulfur Cluster Cochaperone; HscB Iron-Sulfur Cluster Co-Chaperone Homolog; DNAJC20; Epididymis Secretory Sperm Binding Protein; HSC20; J-Type Co-Chaperone HSC20, Isoform CR
-
AA Sequence
MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
-
Predicted Molecular Mass
30.6 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
