IFN-lambda 2/IL-28A Protein, Human (HEK293, His)

IFN-lambda 2 (IL-28A) is a member of the Type-III interferon family. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities^[1]. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs)^[2]. IFN-lambda 2/IL-28A Protein, Human (HEK293, His) is a recombinant human IFN-lambda 2 (V26-V200) with C-terminal 6*His tag, which is expressed in HEK293.

IFN-lambda 2 (IL-28A) is a member of the Type-III interferon family. Human IFN-lambda 2 shares 65.1% common aa identity with mouse. IFN-lambda 2 is produced particularly by dendritic cells (DCs), When following viral or bacterial infection^[3].
IFN-lambda 2 mediates effects by a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 (p48) form a trimeric transcription factor complex (ISGF3). The formed ISGF3 complexes then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs) such as IRF7, MX1, and OAS1^[2].
IFN-lambda 2 has antiviral antitumour and immunomodulatory activities^[1]. IFN-lambda 2 has been reported to modulate CD11c+ DC cell function and promote Th1 differentiation, thus suppressing allergic airway diseases^[4].

IFN-lambda 2 (100 nM, 12 h) protects the epithelial barrier and upregulates the expression of claudin-1 in Caco-2 cells^[6].

IFN-lambda 2 (murine, 2 μg, i.p.) aggravates experimental sepsis in CLP or S. aureus infected mice, facilitates bacterial dissimilation and limits neutrophil recruitment^[5].
IFN-lambda 2 (murine, 0.5 µg, i.p.) protects against intestinal I/R injury in mice^[6].

Human

HEK293

C-6*His

Q8IZJ0 (V26-V200)

282616  [NCBI]

Full Length of Mature Protein

VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Approximately 20 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57(2):171-9.  [Content Brief]

  [2]. Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30(8):555-64.  [Content Brief]

  [3]. Witte K, et al. IL-28A, IL-28B, and IL-29: promising cytokines with type I interferon-like properties. Cytokine Growth Factor Rev. 2010 Aug;21(4):237-51.  [Content Brief]

  [4]. Yan B, et al. Interleukin-28B dampens airway inflammation through up-regulation of natural killer cell-derived IFN-γ. Sci Rep. 2017 Jun 15;7(1):3556.  [Content Brief]

  [5]. Luo Q, et al. Interleukin 28 is a potential therapeutic target for sepsis. Clin Immunol. 2019 Aug;205:29-34.  [Content Brief]

  [6]. Liangzi Li, et al. Interleukin-28A maintains the intestinal epithelial barrier function through regulation of claudin-1.  [Content Brief]