IL-10 Protein, Virus

Customer Review

Based on 1 Customer Validation

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

Background

The IL-10 protein plays a critical role in immune recognition by cytotoxic T-lymphocytes, as it is involved in masking infected cells. It accomplishes this by down-regulating the expression of the host TAP1 gene, which hampers the transport of peptides into the endoplasmic reticulum and their subsequent loading onto MHC class I molecules. Additionally, IL-10 inhibits the synthesis of IFN-gamma. It exists as a homodimer.

Verified Bioactivity

Measured by its ability to inhibit LPS-induced IL-1 beta secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.5804 ng/mL.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-10 (Q26-R170)
      Accession # P03180
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

  • Predicted Molecular Mass

    17.1 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00