Copy Link Print Information

IL-15R alpha & IL-15 Protein, Human (HEK293, His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha & IL-15 Protein, Human (HEK293, His) is a recombinant human IL-15R alpha (I31-S108) & IL-15 (N49-S162) fusion protein with a C-Terminal His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-15R alpha & IL-15 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-15R alpha & IL-15 Protein, Human (HEK293, His)
  • IL-15R alpha & IL-15 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, His) is a recombinant human IL-15R alpha (I31-S108) & IL-15 (N49-S162) fusion protein with a C-Terminal His tag, which is produced in HEK293 cells.

Background

IL-15R alpha is expressed on various cell types, including lymphocytes, myeloid cells, nonlymphoid and nonhematopoietic cells[4]. IL-15 is produced in macrophages and dendritic cells[1].
IL-15R alpha is required for transporting of IL-15 from the endoplasmic reticulum to the cell surface to bind with β (CD122) and γ (CD132) chains on responding lymphocytes[4][5]. When binding with IL-15, the complex increases the in vivo half-life of IL-15 and enhances binding affinity of IL-15 with IL-15Rβ/γ in NK cells and CD8+ T cells. Thus, the signal transmission improves proliferation and antitumor activities of NK cells and CD8+ T cells[2].
IL-15R alpha forms complex with IL-15 and activates the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha/IL-15 complex is a potential immunotherapeutic agent for cancer and viral infection[1].

In Vivo

IL-15R alpha (mouse, pre-complexed with hIL-15, i.p., 15 μg, 200 μL) significantly reduces the tumor volume, and induces an early increase of activated NK cells in B16-F10 melanoma mice[6].
IL-15R alpha & IL-15 Fusion Protein (mouse, i.p., 15 μg & 2.5 μg, 200 μL) causes naive CD8 T cell activation and development into effector cells and long-term memory T cells[7].

Verified Bioactivity

1.Immobilized Human IL-15RA&IL-15, His Tag at 1 μg/mL (100μL/Well) on the plate. Dose response curve for Human IL-2 R beta&IL-2 R gamma, hFc Tag with the EC50 of 0.01-0.2 μg/mL determined by ELISA.
2.Measured in a cell proliferation assay using NK92 cells. The ED50 for this effect is 0.1-1.0 ng/mL.
3.Immobilized Human IL-15RA&IL-15, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Human IL-2 R beta&IL-2 R gamma, hFc Tag with the EC50 of 10-30 ng/mL determined by ELISA.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NK92 cells. The ED50 for this effect is 0.2813 ng/mL, corresponding to a specific activity is 3.555×106 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q13261-1 (I31-S108)&P40933-1 (N49-S162)

  • Gene ID
    3601  [NCBI]&3600  [NCBI]
  • Synonyms

    IL15RA; IL-15 Receptor Subunit Alpha; Interleukin 15 Receptor Subunit Alpha; IL15RA Protein; Interleukin-15 Receptor Subunit Alpha; CD215 Antigen; IL-15RA; IL-15R-Alpha; CD215; Il15ra; Interleukin 15 Receptor, Alpha; IL15; Interleukin-15; Interleukin 15;

  • AA Sequence

    ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSGGSGGGGSGGGSGGGGSGGNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Molecular Weight

    Approximately 26-28 kDa & 30-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Yin Guo, et al. Immunobiology of the IL-15/IL-15Rα complex as an antitumor and antiviral agent. Cytokine Growth Factor Rev. 2017 Dec;38:10-21. [Content Brief]

[2]. Johan Mj Van den Bergh, et al. IL-15 receptor alpha as the magic wand to boost the success of IL-15 antitumor therapies: The upswing of IL-15 transpresentation. Pharmacol Ther. 2017 Feb;170:73-79. [Content Brief]

[3]. Spencer W Stonier, et al. Trans-presentation: a novel mechanism regulating IL-15 delivery and responses. Immunol Lett. 2010 Jan 4;127(2):85-92. [Content Brief]

[4]. Patrick R Burkett, et al. IL-15R alpha expression on CD8+ T cells is dispensable for T cell memory. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4724-9. [Content Brief]

[5]. Emanuela Romano, et al. Human Langerhans cells use an IL-15R-α/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1. Blood. 2012 May 31;119(22):5182-90. [Content Brief]

[6]. Isvoranu G, et al. Immunotherapy in cancer-in vivo study of the anti-tumor activity of the IL-15/IL-15R alfa combination in an experimental model of melanoma[J]. Farmacia, 2015, 63: 631-636.

[7]. Thomas A. Stoklasek, et al. Combined IL-15/IL-15Rα Immunotherapy Maximizes IL-15 Activity In Vivo. J Immunol November 1, 2006, 177 (9) 6072-6080;

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NK92 cells. The ED50 for this effect is 0.2813 ng/mL, corresponding to a specific activity is 3.555×106 units/mg.

  • IL-15R alpha & IL-15 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-15R alpha & IL-15 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-15R alpha & IL-15 Protein, Human (HEK293, His)
  • IL-15R alpha & IL-15 Protein, Human (HEK293, His) Product Image