IL-15R alpha & IL-15 Protein, Human (HEK293, His)

IL-15R alpha is a high affinity receptor for IL-15 (K_d: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell^[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells^[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, His) is a recombinant human IL-15R alpha (I31-S108) & IL-15 (N49-S162) fusion protein with a C-Terminal His tag, which is produced in HEK293 cells.

IL-15R alpha is expressed on various cell types, including lymphocytes, myeloid cells, nonlymphoid and nonhematopoietic cells^[4]. IL-15 is produced in macrophages and dendritic cells^[1].
IL-15R alpha is required for transporting of IL-15 from the endoplasmic reticulum to the cell surface to bind with β (CD122) and γ (CD132) chains on responding lymphocytes^[4][5]. When binding with IL-15, the complex increases the in vivo half-life of IL-15 and enhances binding affinity of IL-15 with IL-15Rβ/γ in NK cells and CD8+ T cells. Thus, the signal transmission improves proliferation and antitumor activities of NK cells and CD8+ T cells^[2].
IL-15R alpha forms complex with IL-15 and activates the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha/IL-15 complex is a potential immunotherapeutic agent for cancer and viral infection^[1].

IL-15R alpha (mouse, pre-complexed with hIL-15, i.p., 15 μg, 200 μL) significantly reduces the tumor volume, and induces an early increase of activated NK cells in B16-F10 melanoma mice^[6].
IL-15R alpha & IL-15 Fusion Protein (mouse, i.p., 15 μg & 2.5 μg, 200 μL) causes naive CD8 T cell activation and development into effector cells and long-term memory T cells^[7].

1.Immobilized Human IL-15RA&IL-15, His Tag at 1 μg/mL (100μL/Well) on the plate. Dose response curve for Human IL-2 R beta&IL-2 R gamma, hFc Tag with the EC₅₀ of 0.01-0.2 μg/mL determined by ELISA.
2.Measured in a cell proliferation assay using NK92 cells. The ED₅₀ for this effect is 0.1-1.0 ng/mL.

Human

HEK293

C-His

Q13261-1 (I31-S108)&P40933-1 (N49-S162)

3601  [NCBI]&3600  [NCBI]

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSGGSGGGGSGGGSGGGGSGGNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Approximately 26-28&30-32 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yin Guo, et al. Immunobiology of the IL-15/IL-15Rα complex as an antitumor and antiviral agent. Cytokine Growth Factor Rev. 2017 Dec;38:10-21.  [Content Brief]

  [2]. Johan Mj Van den Bergh, et al. IL-15 receptor alpha as the magic wand to boost the success of IL-15 antitumor therapies: The upswing of IL-15 transpresentation. Pharmacol Ther. 2017 Feb;170:73-79.  [Content Brief]

  [3]. Spencer W Stonier, et al. Trans-presentation: a novel mechanism regulating IL-15 delivery and responses. Immunol Lett. 2010 Jan 4;127(2):85-92.  [Content Brief]

  [4]. Patrick R Burkett, et al. IL-15R alpha expression on CD8+ T cells is dispensable for T cell memory. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4724-9.  [Content Brief]

  [5]. Emanuela Romano, et al. Human Langerhans cells use an IL-15R-α/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1. Blood. 2012 May 31;119(22):5182-90.  [Content Brief]

  [6]. Isvoranu G, et al. Immunotherapy in cancer-in vivo study of the anti-tumor activity of the IL-15/IL-15R alfa combination in an experimental model of melanoma[J]. Farmacia, 2015, 63: 631-636.

  [7]. Thomas A. Stoklasek, et al. Combined IL-15/IL-15Rα Immunotherapy Maximizes IL-15 Activity In Vivo. J Immunol November 1, 2006, 177 (9) 6072-6080;